tied in with The Unhived Mind website: http://z10.invisionfree.com/The_Unhived_Mind_II/ tied in with The Unhived Mind website: http://z10.invisionfree.com/The_Unhived_Mind_II/ no en http://blip.tv Sun, 19 May 2013 18:20:03 +0000 Sun, 19 May 2013 18:20:03 +0000 B979C00C-C0B0-11E2-976F-A546A1EF707E http://blip.tv/the-unhived-mind/the-protocols-of-the-learned-elders-of-sion-research-by-craig-oxley-youtube-6589590 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6589590 6572901 file TV-UN 0.0 2013-05-19T18:20:03Z English 0 0 0 902 AYOSmXoC http://blip.tv/play/AYOSmXoC http://blip.tv/comments/?attached_to=post6589590&skin=rss Craigoxley-TheProtocolsOfTheLearnedEldersOfSionResearchByCraigO982-463.jpg No license (All rights reserved)
]]> YahooPartnerVideoID Blip post id 6589590 http://blip.tv/file/6572901 Default Category Sun, 19 May 2013 18:20:03 +0000 http://a.images.blip.tv/Craigoxley-TheProtocolsOfTheLearnedEldersOfSionResearchByCraigO982-463.jpg ]]> The Protocols Of The Learned Elders Of Sion - Research by Craig Oxley - YouTube BEF077EE-8F40-11E1-89FC-91CC1B11387D http://blip.tv/the-unhived-mind/maryenig-saturatedfatsfinal-6110811 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6110811 6094003 file TV-UN 0.0 2012-04-26T01:40:04Z English 0 0 0 1750 AYL0_T8C http://blip.tv/play/AYL0_T8C http://blip.tv/comments/?attached_to=post6110811&skin=rss Craigoxley-MaryEnigSaturatedFatsFINAL783-7.jpg No license (All rights reserved)
]]> YahooPartnerVideoID Blip post id 6110811 http://blip.tv/file/6094003 Default Category Thu, 26 Apr 2012 01:40:04 +0000 http://a.images.blip.tv/Craigoxley-MaryEnigSaturatedFatsFINAL783-7.jpg ]]> MaryEnig-SaturatedFatsFINAL FB93BC7A-7BA3-11E1-B418-F494EF0A6A1C http://blip.tv/the-unhived-mind/uhm-stasinukedepop-6059938 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6059938 6043121 file TV-UN 0.0 2012-04-01T02:40:02Z English 0 0 0 1780 AYLx8AYC http://blip.tv/play/AYLx8AYC http://blip.tv/comments/?attached_to=post6059938&skin=rss Craigoxley-UHMSTASINUKEDEPOP178-550.jpg No license (All rights reserved)
]]> YahooPartnerVideoID Blip post id 6059938 http://blip.tv/file/6043121 Default Category Sun, 01 Apr 2012 02:40:02 +0000 http://a.images.blip.tv/Craigoxley-UHMSTASINUKEDEPOP178-550.jpg ]]> UHM-STASINUKEDEPOP 6FC049DC-7754-11E1-8D39-A315D92D3771 http://blip.tv/the-unhived-mind/grover-ericphelpsinterview-6047738 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6047738 6030915 file TV-UN 0.0 2012-03-26T15:00:33Z English 0 0 0 3465 AYLxkF4C http://blip.tv/play/AYLxkF4C http://blip.tv/comments/?attached_to=post6047738&skin=rss Craigoxley-GroverEricPhelpsInterview239-80.jpg No license (All rights reserved)
Rome’s New Inquisition / Dark Age: Phelps on the Jesuits ]]> YahooPartnerVideoID Blip post id 6047738 http://blip.tv/file/6030915 Educational vatican assassins eric jon phelps phelps jesuits society of jesus black pope adolfo nicolas peter hans kolvenbach sabbatean masonic labour frankist zionist jews hofjuden knights of malta columbus shriner shriners jesuit general absolute monarch military o Mon, 26 Mar 2012 15:00:33 +0000 vatican assassins, eric jon phelps, phelps, jesuits, society of jesus, black pope, adolfo nicolas, peter hans kolvenbach, sabbatean, masonic, labour frankist, zionist, jews, hofjuden, knights of malta, columbus, shriner, shriners, jesuit general, absolute monarch, military o http://a.images.blip.tv/Craigoxley-GroverEricPhelpsInterview239-80.jpg vatican assassins, eric jon phelps, phelps, jesuits, society of jesus, black pope, adolfo nicolas, peter hans kolvenbach, sabbatean, masonic, labour frankist, zionist, jews, hofjuden, knights of malta, columbus, shriner, shriners, jesuit general, absolute monarch, military o ]]> DENNIS GROVER INTERVIEWS ERIC JON PHELPS OF VATICAN ASSASSINS 0BD3052A-774C-11E1-BA8F-B63938762491 http://blip.tv/the-unhived-mind/uhm-johncolemaneconhealthmp4-6047609 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6047609 6030786 file TV-UN 0.0 2012-03-26T14:00:29Z English 0 0 0 898 AYLxj10C http://blip.tv/play/AYLxj10C http://blip.tv/comments/?attached_to=post6047609&skin=rss Craigoxley-UHMJOHNCOLEMANECONHEALTHMP4861-667.jpg No license (All rights reserved)
Ever wondered why so many people are sick and dying of illnesses? The biosphere is rampant with viruses and pollutions that are even depopulating the animals as well. Now heres your answer by Dr John Coleman… ]]> YahooPartnerVideoID Blip post id 6047609 http://blip.tv/file/6030786 Educational u.s. president commander-in-chief commander in chief actual service congress constitution declaration of war u.s constitution civil war lincoln priviledge executive orders oliver north deception constitutional scholar new world order nwo martial law habea Mon, 26 Mar 2012 14:00:29 +0000 u.s. president, commander-in-chief, commander in chief, actual service, congress, constitution, declaration of war, u.s constitution, civil war, lincoln, priviledge, executive orders, oliver north, deception, constitutional scholar, new world order, nwo, martial law, habea http://a.images.blip.tv/Craigoxley-UHMJOHNCOLEMANECONHEALTHMP4861-667.jpg u.s. president, commander-in-chief, commander in chief, actual service, congress, constitution, declaration of war, u.s constitution, civil war, lincoln, priviledge, executive orders, oliver north, deception, constitutional scholar, new world order, nwo, martial law, habea ]]> CLUB OF ROME DEPOPULATION OF HUMAN BEINGS FROM EARTH CC8E9BD0-76E8-11E1-A381-D2FB842C08BA http://blip.tv/the-unhived-mind/the-u-s-president-is-not-the-commander-in-chief-6046809 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6046809 6029986 file TV-UN 0.0 2012-03-26T02:10:03Z English 0 0 0 176 AYLxiT0C http://blip.tv/play/AYLxiT0C http://blip.tv/comments/?attached_to=post6046809&skin=rss Craigoxley-UHMJOHNCOLEMANECOMMANDERMP4822-105.jpg No license (All rights reserved)
Constitution specialist Dr John Coleman exposes that the President of the United States is not the Commander-In-Chief you’ve been hoodwinked to believe through repetition indoctrination. ]]> YahooPartnerVideoID Blip post id 6046809 http://blip.tv/file/6029986 Educational u.s. president commander-in-chief commander in chief actual service congress constitution declaration of war u.s constitution civil war lincoln priviledge executive orders oliver north deception constitutional scholar new world order nwo martial law habea Mon, 26 Mar 2012 02:10:03 +0000 u.s. president, commander-in-chief, commander in chief, actual service, congress, constitution, declaration of war, u.s constitution, civil war, lincoln, priviledge, executive orders, oliver north, deception, constitutional scholar, new world order, nwo, martial law, habea http://a.images.blip.tv/Craigoxley-UHMJOHNCOLEMANECOMMANDERMP4822-105.jpg u.s. president, commander-in-chief, commander in chief, actual service, congress, constitution, declaration of war, u.s constitution, civil war, lincoln, priviledge, executive orders, oliver north, deception, constitutional scholar, new world order, nwo, martial law, habea ]]> THE U.S. PRESIDENT IS NOT THE COMMANDER-IN-CHIEF A73572E0-752C-11E1-B9A0-FCA07AAD1ED7 http://blip.tv/the-unhived-mind/uhm-911dvdfre-3of3-6043492 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6043492 6026669 file TV-UN 0.0 2012-03-23T21:10:44Z English 0 0 0 3579 AYLw70gC http://blip.tv/play/AYLw70gC http://blip.tv/comments/?attached_to=post6043492&skin=rss Craigoxley-UHM911DVDFRE3of3291-623.jpg No license (All rights reserved)
* PLEASE MAKE SURE YOU DOWNLOAD THIS VIDEO BEFORE ANY SUPPRESSION * Welcome finally to the real truth behind the 9/11 attacks. Much of what you've heard by the alternative media has been twisted by the National Security Agency and the Intelligence network in order to suit their needs and the beliefs they would like the awakening people to follow. The information provided may shock you if you've never come across any of it before. This 9/11 attack was nothing like you imagined after being steered by the Intelligence false alternative media for all this time. Now is the time for the truth and here it is, enjoy. ]]> YahooPartnerVideoID Blip post id 6043492 http://blip.tv/file/6026669 Educational new world order 9/11 911 wtc7 inside job 911truth wearechange twin towers khalezov granit gapan royal canadian air force nato metabridge mariners nwo conspiracy silverstein Fri, 23 Mar 2012 21:10:44 +0000 new world order, 9/11, 911, wtc7, inside job, 911truth, wearechange, twin towers, khalezov, granit, gapan, royal canadian air force, nato, metabridge, mariners, nwo, conspiracy, silverstein http://a.images.blip.tv/Craigoxley-UHM911DVDFRE3of3291-623.jpg new world order, 9/11, 911, wtc7, inside job, 911truth, wearechange, twin towers, khalezov, granit, gapan, royal canadian air force, nato, metabridge, mariners, nwo, conspiracy, silverstein ]]> THE DARKER SIDE OF 9/11 AND THE FRENCH CONNECTION 3/3 4C26954E-7524-11E1-9ACA-F78478064819 http://blip.tv/the-unhived-mind/uhm-911dvdfre-2of3-6043377 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6043377 6026554 file TV-UN 0.0 2012-03-23T20:10:55Z English 0 0 0 3582 AYLw7lUC http://blip.tv/play/AYLw7lUC http://blip.tv/comments/?attached_to=post6043377&skin=rss Craigoxley-UHM911DVDFRE2of3493-999.jpg No license (All rights reserved)
* PLEASE MAKE SURE YOU DOWNLOAD THIS VIDEO BEFORE ANY SUPPRESSION * Welcome finally to the real truth behind the 9/11 attacks. Much of what you've heard by the alternative media has been twisted by the National Security Agency and the Intelligence network in order to suit their needs and the beliefs they would like the awakening people to follow. The information provided may shock you if you've never come across any of it before. This 9/11 attack was nothing like you imagined after being steered by the Intelligence false alternative media for all this time. Now is the time for the truth and here it is, enjoy. ]]> YahooPartnerVideoID Blip post id 6043377 http://blip.tv/file/6026554 Educational new world order 9/11 911 wtc7 inside job 911truth wearechange twin towers khalezov granit gapan royal canadian air force nato metabridge mariners nwo conspiracy silverstein Fri, 23 Mar 2012 20:10:55 +0000 new world order, 9/11, 911, wtc7, inside job, 911truth, wearechange, twin towers, khalezov, granit, gapan, royal canadian air force, nato, metabridge, mariners, nwo, conspiracy, silverstein http://a.images.blip.tv/Craigoxley-UHM911DVDFRE2of3493-999.jpg new world order, 9/11, 911, wtc7, inside job, 911truth, wearechange, twin towers, khalezov, granit, gapan, royal canadian air force, nato, metabridge, mariners, nwo, conspiracy, silverstein ]]> THE DARKER SIDE OF 9/11 AND THE FRENCH CONNECTION 2/3 4B2EB02C-7524-11E1-8E46-DC53EE0A0C3E http://blip.tv/the-unhived-mind/uhm-911dvdfre-1of3-6043376 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6043376 6026553 file TV-UN 0.0 2012-03-23T20:10:53Z English 0 0 0 3578 AYLw7lQC http://blip.tv/play/AYLw7lQC http://blip.tv/comments/?attached_to=post6043376&skin=rss Craigoxley-UHM911DVDFRE1of3827-246.jpg No license (All rights reserved)
* PLEASE MAKE SURE YOU DOWNLOAD THIS VIDEO BEFORE ANY SUPPRESSION * Welcome finally to the real truth behind the 9/11 attacks. Much of what you've heard by the alternative media has been twisted by the National Security Agency and the Intelligence network in order to suit their needs and the beliefs they would like the awakening people to follow. The information provided may shock you if you've never come across any of it before. This 9/11 attack was nothing like you imagined after being steered by the Intelligence false alternative media for all this time. Now is the time for the truth and here it is, enjoy. ]]> YahooPartnerVideoID Blip post id 6043376 http://blip.tv/file/6026553 Educational new world order 9/11 911 wtc7 inside job 911truth wearechange twin towers khalezov granit gapan royal canadian air force nato metabridge mariners nwo conspiracy silverstein Fri, 23 Mar 2012 20:10:53 +0000 new world order, 9/11, 911, wtc7, inside job, 911truth, wearechange, twin towers, khalezov, granit, gapan, royal canadian air force, nato, metabridge, mariners, nwo, conspiracy, silverstein http://a.images.blip.tv/Craigoxley-UHM911DVDFRE1of3827-246.jpg new world order, 9/11, 911, wtc7, inside job, 911truth, wearechange, twin towers, khalezov, granit, gapan, royal canadian air force, nato, metabridge, mariners, nwo, conspiracy, silverstein ]]> THE DARKER SIDE OF 9/11 AND THE FRENCH CONNECTION 1/3 7DABCD40-7377-11E1-8400-C020D528D6D2 http://blip.tv/the-unhived-mind/english-peace-officer-recruitment-is-taking-place-6038202 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6038202 6021373 file TV-UN 0.0 2012-03-21T17:01:24Z English 0 0 0 96 AYLwxh4C http://blip.tv/play/AYLwxh4C http://blip.tv/comments/?attached_to=post6038202&skin=rss Craigoxley-UHMBCGPEACEOFFICERS585-975.jpg No license (All rights reserved)
England is coming back. The corruption will be dealth with.. ]]> YahooPartnerVideoID Blip post id 6038202 http://blip.tv/file/6021373 Educational new world order nwo england sovereignty freeman admiralty common law nationalism referendum peace officer magna carta freedom constitution Wed, 21 Mar 2012 17:01:24 +0000 new world order, nwo, england, sovereignty, freeman, admiralty, common law, nationalism, referendum, peace officer, magna carta, freedom, constitution http://a.images.blip.tv/Craigoxley-UHMBCGPEACEOFFICERS585-975.jpg new world order, nwo, england, sovereignty, freeman, admiralty, common law, nationalism, referendum, peace officer, magna carta, freedom, constitution ]]> ENGLISH PEACE OFFICER RECRUITMENT IS TAKING PLACE E7FA10FA-7316-11E1-943F-83C1CE348689 http://blip.tv/the-unhived-mind/uhm-pippercy-6036986 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6036986 6020157 file TV-UN 0.0 2012-03-21T05:30:01Z English 0 0 0 201 AYLwvF4C http://blip.tv/play/AYLwvF4C http://blip.tv/comments/?attached_to=post6036986&skin=rss Craigoxley-uhmpippercy477-249.jpg No license (All rights reserved)
Catholic unity ]]> YahooPartnerVideoID Blip post id 6036986 http://blip.tv/file/6020157 Educational percy duke of northumberland perci guy fawkes bonfire nwo new world order conspiracy illuminati truth rothschild zionism Wed, 21 Mar 2012 05:30:01 +0000 percy, duke of northumberland, perci, guy fawkes, bonfire, nwo, new world order, conspiracy, illuminati, truth, rothschild, zionism http://a.images.blip.tv/Craigoxley-uhmpippercy477-249.jpg percy, duke of northumberland, perci, guy fawkes, bonfire, nwo, new world order, conspiracy, illuminati, truth, rothschild, zionism ]]> THE ROTHSCHILD'S ARE TO SCION WITH THE POWERFUL PERCY FAMILY OF ENGLAND [Video] 9F21A834-7311-11E1-B378-D32D676E0E85 http://blip.tv/the-unhived-mind/uhm-aragontemplars-6036936 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6036936 6020107 file TV-UN 0.0 2012-03-21T04:52:11Z English 0 0 0 651 AYLwvCwC http://blip.tv/play/AYLwvCwC http://blip.tv/comments/?attached_to=post6036936&skin=rss Craigoxley-UHMARAGONTEMPLARS500-777.jpg No license (All rights reserved)
All around you is controlled by a force many have no idea about. You live in an invisible prison where many do not wish to break free because they do not see the bars. This system and prison has been created to enslave and control you and has done for hundreds of years. Papal Bull – Unam Sanctam -1302 – Pope Boniface VIII Papal Bull – Aeterni Regist – 1481 – Pope Sixtus IV ]]> YahooPartnerVideoID Blip post id 6036936 http://blip.tv/file/6020107 Educational aragon templars knights templar jesuit order jesuits vatican ihs pope catholic kennedy assassination kennedy jfk new world order nwo Wed, 21 Mar 2012 04:52:11 +0000 aragon templars, knights templar, jesuit order, jesuits, vatican, ihs, pope, catholic, kennedy assassination, kennedy, jfk, new world order, nwo http://a.images.blip.tv/Craigoxley-UHMARAGONTEMPLARS500-777.jpg aragon templars, knights templar, jesuit order, jesuits, vatican, ihs, pope, catholic, kennedy assassination, kennedy, jfk, new world order, nwo ]]> ARAGON TEMPLARISM DOMINATION OF WORLD CONTROL, COMMERCE & THE J.F.K HIT 87273A82-7311-11E1-82FD-9EBF87056776 http://blip.tv/the-unhived-mind/uhm-englishtakeover-6036933 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6036933 6020104 file TV-UN 0.0 2012-03-21T04:51:31Z English 0 0 0 893 AYLwvCkC http://blip.tv/play/AYLwvCkC http://blip.tv/comments/?attached_to=post6036933&skin=rss Craigoxley-uhmenglishtakeover649-371.jpg No license (All rights reserved)
The Nazi U.K. must be taken from the Jesuits back to the hands of the people of the land.. ]]> YahooPartnerVideoID Blip post id 6036933 http://blip.tv/file/6020104 Educational jesuits jesuit order nazi uk government fascism arrest warrant new world order broken britain london riots vatican nwo illuminati conspiracy Wed, 21 Mar 2012 04:51:31 +0000 jesuits, jesuit order, nazi, uk government, fascism, arrest warrant, new world order, broken britain, london riots, vatican, nwo, illuminati, conspiracy http://a.images.blip.tv/Craigoxley-uhmenglishtakeover649-371.jpg jesuits, jesuit order, nazi, uk government, fascism, arrest warrant, new world order, broken britain, london riots, vatican, nwo, illuminati, conspiracy ]]> ENGLISH TAKE OVER OF NAZI U.K. AND THE ARREST OF THE JESUITS BC7BE4B8-7310-11E1-828B-F61DEBED1000 http://blip.tv/the-unhived-mind/uhm-childdestruction-6036923 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6036923 6020094 file TV-UN 0.0 2012-03-21T04:45:51Z English 0 0 0 253 AYLwvB8C http://blip.tv/play/AYLwvB8C http://blip.tv/comments/?attached_to=post6036923&skin=rss Craigoxley-UHMCHILDDESTRUCTION806-265.jpg No license (All rights reserved)
Social Service Kidnapping and drugging of innocent children for population control and reduction. ]]> YahooPartnerVideoID Blip post id 6036923 http://blip.tv/file/6020094 Default Category social services amalfi un agenda 21 sustainable development depopulation club of rome new world order nwo conspiracy illuminati drugs Wed, 21 Mar 2012 04:45:51 +0000 social services, amalfi, un agenda 21, sustainable development, depopulation, club of rome, new world order, nwo, conspiracy, illuminati, drugs http://a.images.blip.tv/Craigoxley-UHMCHILDDESTRUCTION806-265.jpg social services, amalfi, un agenda 21, sustainable development, depopulation, club of rome, new world order, nwo, conspiracy, illuminati, drugs ]]> AMALFI KIDNAPPING OF CHILDREN AND THE U.N AGENDA EAAE0B60-72BE-11E1-AAC3-95D48B8C03DC http://blip.tv/the-unhived-mind/uhm-revagenda-6035761 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6035761 6018932 file TV-UN 0.0 2012-03-20T19:00:10Z English 0 0 0 897 AYLwsxUC http://blip.tv/play/AYLwsxUC http://blip.tv/comments/?attached_to=post6035761&skin=rss Craigoxley-UHMREVAGENDA169-346.jpg No license (All rights reserved)
From the Earthquake to the Crusades... ]]> YahooPartnerVideoID Blip post id 6035761 http://blip.tv/file/6018932 Educational new world order nwo illuminati crusade chaos order out of chaos ordo-ab-chao terrorism disaster truth conspiracy arab uprising middle east russia Tue, 20 Mar 2012 19:00:10 +0000 new world order, nwo, illuminati, crusade, chaos, order out of chaos, ordo-ab-chao, terrorism, disaster, truth conspiracy, arab uprising, middle east, russia http://a.images.blip.tv/Craigoxley-UHMREVAGENDA169-346.jpg new world order, nwo, illuminati, crusade, chaos, order out of chaos, ordo-ab-chao, terrorism, disaster, truth conspiracy, arab uprising, middle east, russia ]]> THE ORDER FROM THE RAGING CHAOS OF 2011 & BEYOND FE6EC756-72B0-11E1-8452-D2C1403C2614 http://blip.tv/the-unhived-mind/craig-oxley-templars-are-coming-6035513 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6035513 6018684 file TV-UN 0.0 2012-03-20T17:20:30Z English 0 0 0 900 AYLwsR0C http://blip.tv/play/AYLwsR0C http://blip.tv/comments/?attached_to=post6035513&skin=rss Craigoxley-CraigOxleyTEMPLARSARECOMING228-530.jpg No license (All rights reserved)
21 Feb 2011 Its very highly possible for an all out attack on the Middle East by the revived Knights Templar as events not noticed by the populace which have and are playing out will soon come into force. If you're in the Middle East prepare for something very big and Iran is most definitely in the Crusaders mind. -- Its very highly possible for an all out attack on the Middle East by the revived Knights Templar as events not noticed by the populace which have and are playing out will soon come into force. If you're in the Middle East prepare for something very big and Iran is most definitely in the Crusaders mind. Latest Updates: 21 Feb 2011; SUEZ CANAL ATTACK BY NUCLEAR OR SCALAR WEAPONRY HITS THE REGION WITH A SUPPOSED EARTHQUAKE OF 5.9 ON THE RICHTER SCALE MONDAY 21 FEB 2011 FOR 27 MINUTES AT 03:00 HOURS. A NUCLEAR WEAPON OF 150 KILOTON IS ENOUGH TO GIVE A 5.9 ON THE RICHTER SCALE. WAS THIS MORE LIKELY AN ISRAELI NUCLEAR DETONATION? 22 Feb 2011; Notice Russia, Medvedev meets leaders of Russian parliamentary parties on Saturday 19th of February only 2 days after his Vatican City visit. 23 Feb 2011; ECONOMIC COLLAPSE MAY ARISE FROM THE COMING EVENTS IN THE MIDDLE EAST OVER THE NEXT FEW WEEKS OR MONTHS. THIS WILL LEAD TO THE MOSLEM WORLD BEING BLAMED IN THE WEST FOR THE ECONOMIC COLLAPSE AND DESTRUCTION OF WESTERNERS LIFESTYLES. THERE WILL BE NO JOBS, HATRED WILL BE GREAT AND PEOPLE WILL TURN TO THE MILITARY FOR REVENGE MANY WILL SEEK A HOLY WAR WHICH IS THE VERY DESIRE OF THE VATICAN TO DESTROY BOTH CHRISTIANITY AND ZIONISM IN THE END AS HIGHLIGHTED BY SOVEREIGN COMMANDER, ALBERT PIKE. 24 Feb 2011; NOT ONLY HAS THE GUARDIAN NEWSPAPER IN THE U.K. MENTIONED THE $220 OIL PRICE, WE NOW HAVE THE U.S. MEDIA OF FOX NEWS AND BLOOMBERG REPORTING EXACTLY THE SAME. MAY I REMIND YOU FOX NEWS IS A BRITISH INTELLIGENCE NEST RUN BY KNIGHT OF MALTA, RUPERT MURDOCH (KNIGHT OF ST GREGORY THE GREAT) AND MICHAEL BLOOMBERG IS A KNIGHT OF MALTA WHO LICKS THE BOOTS OF EQUESTRIAN ORDER OF THE HOLY SEPULCHRE KNIGHT, CARDINAL EDWARD EGAN AND KNIGHT OF MALTA, ARCHBISHOP TIMOTHY DOLAN. 24 Feb 2011; Folks please notice how Yahoo News of the mainstream whores of the Club of Isles places a picture of Medvedev with King Juan Carlos of Spain. How appropriate to those of us who understand the structure of this unHoly Roman Empire. -The Unhived Mind http://i105.photobucket.com/albums/m202/anunnaki_2006/MEDVEDEVCARLOS.jpg 24 Feb 2011 - Now they're claiming Syria has four new nuclear sites. 25 Feb 2011: The U,N now coming up with more propaganda against Iran over military nuclear capabilities. 25 Feb 2011 - THE JCOS Adm Mullen is down in the Middle East for a six days. 25 Feb 2011 - Knight of Malta, RIck Santorum pushes the 'Crusade'; http://z10.invisionfree.com/The_Unhived_Mind_II/index.php?showtopic=53156 28 Feb 2011 - European Parliament President, Jerzy Buzek meets Pope Benedict XVI at the Vatican along with Knight of Malta Grandmaster, Matthew Festing and Grand Chancellor, Jean-Pierre Mazery. Notice the talk of the situation in North Africa. 01 Mar 2011 - The Pentagon try to make claims that Terrorists were behind the 2008 economic crisis. This will further aid in the blaming of Moslems for all the World's trouble as Westerners enter into poverty and the post industrial zero growth society. Westerners will turn on local Moslems and against the Moslem World as this eventually escalates into the Vatican's Holy war they've always desired along with this Clash of Civilisations. 03 Mar 2011 .. King Juan Carlos is in Kuwait 04 Mar 2011 .. Notice how even SEYMOUR HERSH has now connected the KNIGHTS OF MALTA to the U.S. Military's Joint Special Operations Command. Also note how he speaks of the current troubles as a Crusade. The KNIGHTS OF MALTA are certainly not happen at this well known respected being speaking this truth finally. 15 Mar 2011 - King Juan Carlos has spoken with King Abdullah this week take a look at this article; http://z10.invisionfree.com/The_Unhived_Mind_II/index.php?showtopic=54632 20 Mar 2011 .. King Juan Carlos phones with his orders to Bahrain's King Hamad bin Isa Al Khalifa 21 Mar 2011 .. Please beware that the General of the Knights of the Virgin Mary IHS revived Spanish Templars (Los Alumbrados) will be visiting Peter Hans Kolvenbach SJ the covert true power of the Order during this era of the two Generals. Adolfo Nicolas SJ will be visiting Lebanon, Turkey and Syria from today 11 Apr 2011 .. President Obama is to send Israel $205 million to fund additional Iron Dome batteries in the south, "IDF Radio" (Galei Zahal) reported this morning http://www.globes.co.il/serveen/globes/docview.asp?did=1000637227&fid=942 02 May 2011 - Yemeni President Ali Abdullah Saleh fingers Qatar for Middle East unrest and who do we see meeting with JUAN CARLOS OF SPAIN in April 2011? Why its the Emir of Qatar getting his instructions; http://z10.invisionfree.com/The_Unhived_Mind_II/index.php?showtopic=57525 ]]> YahooPartnerVideoID Blip post id 6035513 http://blip.tv/file/6018684 Educational new world order nwo crusade templars knights templar roman empire middle east arab spring arab uprising syria free syrian army libya invasion war conflict illuminati conspiracy natural resources st lazare foundation king juan carlos bourbon Tue, 20 Mar 2012 17:20:30 +0000 new world order, nwo, crusade, templars, knights templar, roman empire, middle east, arab spring, arab uprising, syria, free syrian army, libya, invasion, war, conflict, illuminati, conspiracy, natural resources, st lazare foundation, king juan carlos, bourbon http://a.images.blip.tv/Craigoxley-CraigOxleyTEMPLARSARECOMING228-530.jpg new world order, nwo, crusade, templars, knights templar, roman empire, middle east, arab spring, arab uprising, syria, free syrian army, libya, invasion, war, conflict, illuminati, conspiracy, natural resources, st lazare foundation, king juan carlos, bourbon ]]> ALERT - TEMPLAR ATTACK ON THE MIDDLE EAST FROM FEB 26 2011 ONWARDS AFF4EDA2-7248-11E1-8D92-CCC3A3714F09 http://blip.tv/the-unhived-mind/craigoxley-chris-story-africa-connection-mp4-6034375 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6034375 6017546 file TV-UN 0.0 2012-03-20T04:53:51Z English 0 0 0 900 AYLwqCsC http://blip.tv/play/AYLwqCsC http://blip.tv/comments/?attached_to=post6034375&skin=rss Craigoxley-CraigOxleyChrisStoryAfricaConnectionMP4231-960.jpg No license (All rights reserved)
Edwarde Harle, Tony Blair and the Nazi African Connection ]]> YahooPartnerVideoID Blip post id 6034375 http://blip.tv/file/6017546 Educational africa nigeria oil tony blair edware harle story assassination bush dvd new world order order skull and bones bush family oil Tue, 20 Mar 2012 04:53:51 +0000 africa, nigeria, oil, tony blair, edware harle, story, assassination, bush, dvd, new world order, order, skull and bones, bush family, oil http://a.images.blip.tv/Craigoxley-CraigOxleyChrisStoryAfricaConnectionMP4231-960.jpg africa, nigeria, oil, tony blair, edware harle, story, assassination, bush, dvd, new world order, order, skull and bones, bush family, oil ]]> STORY ASSASSINATION & THE NAZI, AFRICA CONNECTION [Video] 99957932-7234-11E1-A51F-9A56A1EA3B9A http://blip.tv/the-unhived-mind/craigoxley-oldeuropemoslemflv-6034232 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6034232 6017403 file TV-UN 0.0 2012-03-20T02:30:03Z English 0 0 0 895 AYLwpxwC http://blip.tv/play/AYLwpxwC http://blip.tv/comments/?attached_to=post6034232&skin=rss Craigoxley-CraigOxleyOldEuropeMoslemFLV240-860.jpg No license (All rights reserved)
25 Oct 2010 Highlighting the real power over the globe and Middle East along with symbolism and what lies ahead. The real forces behind the creation of the movie version of ‘Angels & Demons’ and King Solomon’s Third Temple and far more. Its time the real enemy was exposed. For further research of your own, study the Spanish Inquisitional power of Borgo Pio (mostly shipped to Shanghai, China and Vietnam) along with Borgo Santo Spirito. I also suggest people research all the work of Prof Walter J. Veith and his Total Onslaught series. You should study the Islamic Connection episode closely. ]]> YahooPartnerVideoID Blip post id 6034232 http://blip.tv/file/6017403 Educational papacy moslem muslim islam muslim brotherhood middle east arabs arab uprising holy see roman empire pope pallavicini inter-religious dialogue new world order nwo illuminati Tue, 20 Mar 2012 02:30:03 +0000 papacy, moslem, muslim, islam, muslim brotherhood, middle east, arabs, arab uprising, holy see, roman empire, pope, pallavicini, inter-religious dialogue, new world order, nwo, illuminati http://a.images.blip.tv/Craigoxley-CraigOxleyOldEuropeMoslemFLV240-860.jpg papacy, moslem, muslim, islam, muslim brotherhood, middle east, arabs, arab uprising, holy see, roman empire, pope, pallavicini, inter-religious dialogue, new world order, nwo, illuminati ]]> THE PAPACY CONTROL THE WORLD & THE MOSLEMS 3B819EE6-722C-11E1-8C82-8996DF317E3D http://blip.tv/the-unhived-mind/uhm-ordochaoscot-6034150 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6034150 6017321 file TV-UN 0.0 2012-03-20T01:30:10Z English 0 0 0 277 AYLwpkoC http://blip.tv/play/AYLwpkoC http://blip.tv/comments/?attached_to=post6034150&skin=rss Craigoxley-uhmORDOCHAOSCOT135-918.jpg No license (All rights reserved)
From organized riots to the Military Conscription of demonized youth. ]]> YahooPartnerVideoID Blip post id 6034150 http://blip.tv/file/6017321 Default Category rioting british riots civil unrest london riots new world order nwo illuminati conspiracy truth conscription police state martial law private security Tue, 20 Mar 2012 01:30:10 +0000 rioting, british riots, civil unrest, london riots, new world order, nwo, illuminati, conspiracy, truth, conscription, police state, martial law, private security http://a.images.blip.tv/Craigoxley-uhmORDOCHAOSCOT135-918.jpg rioting, british riots, civil unrest, london riots, new world order, nwo, illuminati, conspiracy, truth, conscription, police state, martial law, private security ]]> BRITISH SUMMER RIOTS AND THE POLICE STATE AGENDA A00BBAFA-7226-11E1-8623-F5A0E073C13E http://blip.tv/the-unhived-mind/uhm-templarescalation-6034108 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6034108 6017279 file TV-UN 0.0 2012-03-20T00:50:01Z English 0 0 0 85 AYLwpiAC http://blip.tv/play/AYLwpiAC http://blip.tv/comments/?attached_to=post6034108&skin=rss Craigoxley-uhmtemplarescalation273-299.jpg No license (All rights reserved)
Get ready for the ramping up of the Middle East action. A video made way back in 2011 ]]> YahooPartnerVideoID Blip post id 6034108 http://blip.tv/file/6017279 Default Category knights templar crusade libya gaddafi oil natural resources nwo new world order illuminati roman empire middle east arab spring revolution illuminati conspiracy Tue, 20 Mar 2012 00:50:01 +0000 knights templar, crusade, libya, gaddafi, oil, natural resources, nwo, new world order, illuminati, roman empire, middle east, arab spring, revolution, illuminati, conspiracy http://a.images.blip.tv/Craigoxley-uhmtemplarescalation273-299.jpg knights templar, crusade, libya, gaddafi, oil, natural resources, nwo, new world order, illuminati, roman empire, middle east, arab spring, revolution, illuminati, conspiracy ]]> Knights Templar Escalation of Tensions in the Middle East 740D6312-7222-11E1-92CD-EC55A4224246 http://blip.tv/the-unhived-mind/uhm-foodcrisisfinalmp4-6034052 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6034052 6017223 file TV-UN 0.0 2012-03-20T00:20:09Z English 0 0 0 613 AYLwpWgC http://blip.tv/play/AYLwpWgC http://blip.tv/comments/?attached_to=post6034052&skin=rss Craigoxley-UHMFOODCRISISFINALMP4984-810.jpg No license (All rights reserved)
14 Jan 2011 At this very minute the populace of the U.K are being subliminally conditioned to the coming food crisis and rationing which will take place. Only weeks ago TESCO announced to its loyalty card (Big Brother) customers that they’d be delving deeper into their customers purchases. Loyalty cards are so in the future supermarkets will know what your weekly shop usually is and then you’ll no longer be able to purchase anything over this amount. The elitists do not want food hoarders as this doesn’t allow for control. ]]> YahooPartnerVideoID Blip post id 6034052 http://blip.tv/file/6017223 Default Category supermarkets co-op co-operative mind conditioning food crisis famine food shortage population reduction depopulation endgame new world order club of rome nwo illuminati conspiracy food Tue, 20 Mar 2012 00:20:09 +0000 supermarkets, co-op, co-operative, mind conditioning, food crisis, famine, food shortage, population reduction, depopulation, endgame, new world order, club of rome, nwo, illuminati, conspiracy, food http://a.images.blip.tv/Craigoxley-UHMFOODCRISISFINALMP4984-810.jpg supermarkets, co-op, co-operative, mind conditioning, food crisis, famine, food shortage, population reduction, depopulation, endgame, new world order, club of rome, nwo, illuminati, conspiracy, food ]]> U.K. POPULACE ARE BEING CONDITIONED FOR FOOD CRISIS AND RATIONING 8F34125C-71F1-11E1-BBC2-A6B9DCB68288 http://blip.tv/the-unhived-mind/uhm-jpnnukesus-6033116 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6033116 6016284 file TV-UN 0.0 2012-03-19T18:30:10Z English 0 0 0 785 AYLwnkAC http://blip.tv/play/AYLwnkAC http://blip.tv/comments/?attached_to=post6033116&skin=rss Craigoxley-uhmjpnnukesus201-356.jpg No license (All rights reserved)
The World has been attacked by radiation, spread on purpose to meet demands of the small few who want the large mass to be gone from this planet. Enjoy the real hard hitting truth saying within this video like no other on the subject before it. If you wanted to know the real enemy of Japan and the World you soon will have the answer by the end of this video. ]]> YahooPartnerVideoID Blip post id 6033116 http://blip.tv/file/6016284 Educational fukushima nukes radiation radioactive nwo new world order japanese earthquake tsunami crown stuxnet malware siemens meltdown nuclear reactor Mon, 19 Mar 2012 18:30:10 +0000 fukushima, nukes, radiation, radioactive, nwo, new world order, japanese earthquake, tsunami, crown, stuxnet, malware, siemens, meltdown, nuclear reactor http://a.images.blip.tv/Craigoxley-uhmjpnnukesus201-356.jpg fukushima, nukes, radiation, radioactive, nwo, new world order, japanese earthquake, tsunami, crown, stuxnet, malware, siemens, meltdown, nuclear reactor ]]> JAPANESE EARTHQUAKE THE STUXNET NUCLEAR WAR & THE SUSPECTS BEHIND IT 8EA9E2C8-71EA-11E1-87A8-DE2A3EC14EA7 http://blip.tv/the-unhived-mind/uhm-crownjap-6032996 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6032996 6016164 file TV-UN 0.0 2012-03-19T17:40:02Z English 0 0 0 88 AYLwnUgC http://blip.tv/play/AYLwnUgC http://blip.tv/comments/?attached_to=post6032996&skin=rss Craigoxley-UHMCROWNJAP653-130.jpg No license (All rights reserved)
The City of London were behind the 3/11 disaster ]]> YahooPartnerVideoID Blip post id 6032996 http://blip.tv/file/6016164 Educational fukushima japan earthquake superquake 3/11 tsunami city of london livery conspiracy mercers new world order nwo attack on japan radiation wmd radioactive nuclear reactor new world order nwo Mon, 19 Mar 2012 17:40:02 +0000 fukushima, japan earthquake, superquake, 3/11, tsunami, city of london, livery, conspiracy, mercers, new world order, nwo, attack on japan, radiation, wmd, radioactive, nuclear reactor, new world order, nwo http://a.images.blip.tv/Craigoxley-UHMCROWNJAP653-130.jpg fukushima, japan earthquake, superquake, 3/11, tsunami, city of london, livery, conspiracy, mercers, new world order, nwo, attack on japan, radiation, wmd, radioactive, nuclear reactor, new world order, nwo ]]> JAPAN EARTHQUAKE WAS NUCLEAR TERRORISM BY THE CROWN AGENTS 2A33875A-71E9-11E1-BC90-85CF1254F819 http://blip.tv/the-unhived-mind/uhm-japanossfull-6032972 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6032972 6016140 file TV-UN 0.0 2012-03-19T17:30:04Z English 0 0 0 1216 AYLwnTAC http://blip.tv/play/AYLwnTAC http://blip.tv/comments/?attached_to=post6032972&skin=rss Craigoxley-UHMJAPANOSSfull752-998.jpg No license (All rights reserved)
11 Mar 2011 Check out these old 1945 documents from the Office of Strategic Services the original CIA back then. ]]> YahooPartnerVideoID Blip post id 6032972 http://blip.tv/file/6016140 Educational fukushima nuclear japan radiation tsunami 3/11 radioactive iodine 131 thryoid cancer cancers oss japanese faultlines war on japan nwo new world order conspiracy truth illuminati Mon, 19 Mar 2012 17:30:04 +0000 fukushima, nuclear japan, radiation, tsunami, 3/11 radioactive, iodine 131, thryoid cancer, cancers, oss, japanese faultlines, war on japan, nwo, new world order, conspiracy, truth, illuminati http://a.images.blip.tv/Craigoxley-UHMJAPANOSSfull752-998.jpg fukushima, nuclear japan, radiation, tsunami, 3/11 radioactive, iodine 131, thryoid cancer, cancers, oss, japanese faultlines, war on japan, nwo, new world order, conspiracy, truth, illuminati ]]> JAPANESE EARTHQUAKE 2011 – O.S.S SECRET PLANS TO NUKE JAPAN FAULTLINES 4F19F65E-717F-11E1-9251-E91967636978 http://blip.tv/the-unhived-mind/uhm-japeqoccult-6031859 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6031859 6015025 file TV-UN 0.0 2012-03-19T04:52:19Z English 0 0 0 592 AYLwlFcC http://blip.tv/play/AYLwlFcC http://blip.tv/comments/?attached_to=post6031859&skin=rss Craigoxley-UHMJAPEQOCCULT348-682.jpg No license (All rights reserved)
11 Mar 2011 Did the Japanese superquake really come naturally and from a Coronal Mass Ejection as claimed by NASA? Remember whilst possible, you should know that the populace gets whats called the third truth. A bunch of non truths just to keep you all happy. So what just might be the first truth and why? ]]> YahooPartnerVideoID Blip post id 6031859 http://blip.tv/file/6015025 Default Category fukushima japanese earthquake earthquake nuclear radiation radioactivity meltdown tsunami 3/11 earthquake quake superquake haarp nuclear weapons ses new world order nwo illuminati conspiracy Mon, 19 Mar 2012 04:52:19 +0000 fukushima, japanese earthquake, earthquake, nuclear, radiation, radioactivity, meltdown, tsunami, 3/11, earthquake, quake, superquake, haarp, nuclear weapons, ses, new world order, nwo, illuminati, conspiracy http://a.images.blip.tv/Craigoxley-UHMJAPEQOCCULT348-682.jpg fukushima, japanese earthquake, earthquake, nuclear, radiation, radioactivity, meltdown, tsunami, 3/11, earthquake, quake, superquake, haarp, nuclear weapons, ses, new world order, nwo, illuminati, conspiracy ]]> JAPANESE EARTHQUAKE 2011 WHO'S REALLY BEHIND IT? 32BF9488-717E-11E1-94F1-94E3BC6C8C1E http://blip.tv/the-unhived-mind/uhm-libyavulture-6031849 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6031849 6015015 file TV-UN 0.0 2012-03-19T04:44:22Z English 0 0 0 186 AYLwlE0C http://blip.tv/play/AYLwlE0C http://blip.tv/comments/?attached_to=post6031849&skin=rss Craigoxley-UHMLIBYAVULTURE818-652.jpg No license (All rights reserved)
23 Aug 2011 The Crown Maltese controlled puppet vultures are out in force to pick the flesh off the Libyan carcass in the most despicable conflict seen since 2003. ]]> YahooPartnerVideoID Blip post id 6031849 http://blip.tv/file/6015015 Default Category crown maltese vultures libya libyan invasion gaddafi st lazare foundation water aquifier king juan carlos new world order nwo conspiracy oil petrodollar Mon, 19 Mar 2012 04:44:22 +0000 crown maltese, vultures, libya, libyan invasion, gaddafi, st lazare foundation, water aquifier, king juan carlos, new world order, nwo, conspiracy, oil, petrodollar http://a.images.blip.tv/Craigoxley-UHMLIBYAVULTURE818-652.jpg crown maltese, vultures, libya, libyan invasion, gaddafi, st lazare foundation, water aquifier, king juan carlos, new world order, nwo, conspiracy, oil, petrodollar ]]> THE VULTURES PICK THE FLESH OF LIBYA 3104ECE2-717E-11E1-85F2-A3181B3F0862 http://blip.tv/the-unhived-mind/uhm-kahnbankpanic-6031848 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6031848 6015014 file TV-UN 0.0 2012-03-19T04:44:20Z English 0 0 0 707 AYLwlEwC http://blip.tv/play/AYLwlEwC http://blip.tv/comments/?attached_to=post6031848&skin=rss Craigoxley-UHMKAHNBANKPANIC256-222.jpg No license (All rights reserved)
7 Jul 2011 Have you wondered why the last I.M.F head, Dominique Strauss-Kahn was removed and attacked so vicious and swiftly? Wondering why Timothy Geithner is about to leave his position shortly? Well here’s more insight for you. ]]> YahooPartnerVideoID Blip post id 6031848 http://blip.tv/file/6015014 Educational u.s treasury geither nwo new world order conspiracy dsk dominique strauss-kahn strauss-kahn rape prostitute goldman sachs jpmorgan dimon blankfein illuminati Mon, 19 Mar 2012 04:44:20 +0000 u.s treasury, geither, nwo, new world order, conspiracy, dsk, dominique strauss-kahn, strauss-kahn, rape, prostitute, goldman sachs, jpmorgan, dimon, blankfein, illuminati http://a.images.blip.tv/Craigoxley-UHMKAHNBANKPANIC256-222.jpg u.s treasury, geither, nwo, new world order, conspiracy, dsk, dominique strauss-kahn, strauss-kahn, rape, prostitute, goldman sachs, jpmorgan, dimon, blankfein, illuminati ]]> THE TRUTH ON DOMINIQUE STRAUSS-KAHN, J.P MORGAN & THE FALL OF GEITHNER D1904BCE-6581-11E1-A957-F0CCCB993A06 http://blip.tv/the-unhived-mind/world-war-3-u-k-policing-preparations-as-told-by-david-icke-in-2008-6000040 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 6000040 5983189 file TV-UN 0.0 2012-03-03T22:40:03Z English 0 0 0 612 AYLunAwC http://blip.tv/play/AYLunAwC http://blip.tv/comments/?attached_to=post6000040&skin=rss Craigoxley-DavidIckeTrafficWardens850-604.jpg No license (All rights reserved)
WORLD WAR 3 U.K. POLICING PREPARATIONS AS TOLD BY DAVID ICKE IN 2008 also check out: WE WERE RIGHT: PRIVATE SECURITY FIRMS TO TAKE OVER U.K. POLICE DUTIES http://theunhivedmind.com/wordpress/?p=24416 ]]> YahooPartnerVideoID Blip post id 6000040 http://blip.tv/file/5983189 Default Category nwo new world order world war 3 ww3 iran war private security policing david icke icke illuminati conspiracy g4s serco geo group Sat, 03 Mar 2012 22:40:03 +0000 nwo, new world order, world war 3, ww3, iran war, private security policing, david icke, icke, illuminati, conspiracy, g4s, serco, geo group http://a.images.blip.tv/Craigoxley-DavidIckeTrafficWardens850-604.jpg nwo, new world order, world war 3, ww3, iran war, private security policing, david icke, icke, illuminati, conspiracy, g4s, serco, geo group ]]> WORLD WAR 3 U.K. POLICING PREPARATIONS AS TOLD BY DAVID ICKE IN 2008 A21232FC-546C-11E1-94A0-EFF260FB69FE http://blip.tv/the-unhived-mind/bob-chapman-on-the-dubai-default-feb-2012-5950053 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5950053 5933158 file TV-UN 0.0 2012-02-11T04:55:35Z English 0 0 0 179 AYLrlUkC http://blip.tv/play/AYLrlUkC http://blip.tv/comments/?attached_to=post5950053&skin=rss Craigoxley-BobChapmanOnTheDubaiDefaultFeb2012135-396.jpg No license (All rights reserved)
Listen to Bob Chapman speak about the Dubai credit crisis going on this week in February 2012. For full information check out: http://theunhivedmind.com/wordpress/?p=22119 The audios of Bob come from the Melody Cedarstrom radio show and The Marines Disquisition radio show both broadcast between the 5th-9th February 2012 ]]> YahooPartnerVideoID Blip post id 5950053 http://blip.tv/file/5933158 Art new world order nwo bob chapman chapman dubai dp world illuminati economy depression recession middle east stock markets trading business economics default bankruptcy bankrupt dubai dp world Sat, 11 Feb 2012 04:55:35 +0000 new world order, nwo, bob chapman, chapman, dubai, dp world, illuminati, economy, depression, recession, middle east, stock markets, trading, business, economics, default, bankruptcy, bankrupt, dubai, dp world http://a.images.blip.tv/Craigoxley-BobChapmanOnTheDubaiDefaultFeb2012135-396.jpg new world order, nwo, bob chapman, chapman, dubai, dp world, illuminati, economy, depression, recession, middle east, stock markets, trading, business, economics, default, bankruptcy, bankrupt, dubai, dp world ]]> Bob Chapman on the Dubai Default Feb 2012 7DB0432E-53B6-11E1-BFA9-D9AFDCA61862 http://blip.tv/the-unhived-mind/the-aragon-templar-and-the-rothschild-alliance-5947444 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5947444 5930546 file TV-UN 0.0 2012-02-10T07:11:45Z English 0 0 0 804 AYLrgRgC http://blip.tv/play/AYLrgRgC http://blip.tv/comments/?attached_to=post5947444&skin=rss Craigoxley-TheAragonTemplarAndTheRothschildAlliance402-622.jpg No license (All rights reserved)
The Aragon Templars needed an alliance after their suppression. Who did they use as puppets to takeover the Holy See? ]]> YahooPartnerVideoID Blip post id 5947444 http://blip.tv/file/5930546 Educational the unhived mind uhm unhived mind edward de vere dope inc abraham lincoln lincoln assassination palmer privy council mercers mercer new world order conspiracy nwo freemasonry occult ritual rite jesuits jesuit order jesuit jesutism ihs society of jesus cat Fri, 10 Feb 2012 07:11:45 +0000 the unhived mind, uhm, unhived mind, edward de vere, dope inc, abraham lincoln, lincoln, assassination, palmer, privy council, mercers, mercer, new world order, conspiracy, nwo, freemasonry, occult, ritual, rite, jesuits, jesuit order, jesuit, jesutism, ihs, society of jesus, cat http://a.images.blip.tv/Craigoxley-TheAragonTemplarAndTheRothschildAlliance402-622.jpg the unhived mind, uhm, unhived mind, edward de vere, dope inc, abraham lincoln, lincoln, assassination, palmer, privy council, mercers, mercer, new world order, conspiracy, nwo, freemasonry, occult, ritual, rite, jesuits, jesuit order, jesuit, jesutism, ihs, society of jesus, cat ]]> The Aragon Templar and the Rothschild Alliance 0137EA06-4FB3-11E1-A7C3-D6E84A07DD7F http://blip.tv/the-unhived-mind/merchant-knights-lance-the-japanese-people-5934721 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5934721 5917799 file TV-UN 0.0 2012-02-05T04:36:43Z English 0 0 0 1209 AYLqnWUC http://blip.tv/play/AYLqnWUC http://blip.tv/comments/?attached_to=post5934721&skin=rss Craigoxley-MerchantKnightsLanceTheJapanesePeople324-704.jpg No license (All rights reserved)
The land of Japan is under attack economically and physically by evil superpowers hidden from plain sight. ]]> YahooPartnerVideoID Blip post id 5934721 http://blip.tv/file/5917799 Art nwo new world order bush george h.w bush bush family toyota japan japan economy sony ron paul jesuits illuminati freemasonry occult roman empire 3/11 fukushima stuxnet radiation truth conspiracy nuclear fulford city of london vatican jesuit order cia gm g Sun, 05 Feb 2012 04:36:43 +0000 nwo, new world order, bush, george h.w bush, bush family, toyota, japan, japan economy, sony, ron paul, jesuits, illuminati, freemasonry, occult, roman empire, 3/11, fukushima, stuxnet, radiation, truth, conspiracy, nuclear, fulford, city of london, vatican, jesuit order, cia, gm, g http://a.images.blip.tv/Craigoxley-MerchantKnightsLanceTheJapanesePeople324-704.jpg nwo, new world order, bush, george h.w bush, bush family, toyota, japan, japan economy, sony, ron paul, jesuits, illuminati, freemasonry, occult, roman empire, 3/11, fukushima, stuxnet, radiation, truth, conspiracy, nuclear, fulford, city of london, vatican, jesuit order, cia, gm, g ]]> Merchant Knights Lance the Japanese People DC5DE6F8-40AE-11E1-AED3-C6B7C0C91A84 http://blip.tv/the-unhived-mind/ex-citibank-senior-executive-james-f-wood-16-jan-2012-big-economic-downturn-2013-5890712 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5890712 5873733 file TV-UN 0.0 2012-01-17T01:59:16Z English 0 0 0 1676 AYLnxXwC http://blip.tv/play/AYLnxXwC http://blip.tv/comments/?attached_to=post5890712&skin=rss Craigoxley-ExCitibankSeniorExecutiveJamesFWood16Jan2012BigEcon819-818.jpg No license (All rights reserved)
Listen to Rick Wiles interview James F Wood on the 16th of January 2012 via the TruNews Radio Show. ]]> YahooPartnerVideoID Blip post id 5890712 http://blip.tv/file/5873733 Educational economy nwo order freemasonry depression recession collapse crash citibank downturn slowdown contagion pigs efsf esm eurozone euro currency chapman schiff celente business stocks keynesian economics illuminati credit banks rothschild debt crisis bankrupt Tue, 17 Jan 2012 01:59:16 +0000 economy, nwo, order, freemasonry, depression, recession, collapse, crash, citibank, downturn, slowdown, contagion, pigs, efsf, esm, eurozone, euro, currency, chapman, schiff, celente, business, stocks, keynesian, economics, illuminati, credit, banks, rothschild, debt, crisis, bankrupt http://a.images.blip.tv/Craigoxley-ExCitibankSeniorExecutiveJamesFWood16Jan2012BigEcon819-818.jpg economy, nwo, order, freemasonry, depression, recession, collapse, crash, citibank, downturn, slowdown, contagion, pigs, efsf, esm, eurozone, euro, currency, chapman, schiff, celente, business, stocks, keynesian, economics, illuminati, credit, banks, rothschild, debt, crisis, bankrupt ]]> Ex Citibank Senior Executive, James F Wood - 16 Jan 2012 - big economic downturn 2013 FA73EDA8-3466-11E1-BFC7-ADDF0E9C2E86 http://blip.tv/the-unhived-mind/japan-hit-with-7-0-earthquake-warning-by-crown-maltese-over-u-s-dollar-5857989 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5857989 5840978 file TV-UN 0.0 2012-01-01T10:54:29Z English 0 0 0 390 AYLlxikC http://blip.tv/play/AYLlxikC http://blip.tv/comments/?attached_to=post5857989&skin=rss Craigoxley-JAPANHITWITH70EARTHQUAKEWARNINGBYCROWNMALTESEOVERUSDO961-54.jpg No license (All rights reserved)
The Crown Maltese have given a warning to Japan today the 1st of January 2012. If Japan continues to not play ball in the overt and covert economic system and threaten the U.S. Dollar then Japan will see '3/11 Part II 'The Aftershock'' which this time will destroy Tokyo as threatened previously. This may even be the second warning due to an Earthquake in Central Japan weeks back. Japan is fighting an enemy with very dangerous covert weaponry the populace have had zero idea about. Weapons which can cause great disasters yet aid in veiling that the disaster is really warfare. Do your homework on the subject. http://theunhivedmind.com/wordpress/?p=18072 JAPANESE EARTHQUAKE 2011 - O.S.S SECRET PLANS TO NUKE JAPAN FAULTLINES http://www.youtube.com/watch?v=vqi6_UbOP-g http://www.youtube.com/watch?v=ZG-zABjZ7sM Benjamin Fulford on Strange Universe Radio with Sean David Morton - December 29th, 2011 http://www.youtube.com/watch?v=4EDS795lGOU Video Backups: http://vimeo.com/34426710 http://www.youtube.com/watch?v=VxJHxvN1Dxc http://blip.tv/the-unhived-mind/japan-hit-with-7-0-earthquake-warning-by-crown-maltese-over-u-s-dollar-5857989 http://powervideotube.com/video/H6U61MGR5B62/JAPAN-HIT-WITH-70-EARTHQUAKE-WARNING-BY-CROWN-MALTESE-OVER-US-DOLLAR#current_more_user_vids ]]> YahooPartnerVideoID Blip post id 5857989 http://blip.tv/file/5840978 Educational 3/11 fukushima earthquake japan southern pacific island dollar japan-china nwo haarp nuclear knights of malta city of london vatican jesuits conspiracy zionism rothschild new world order usgs esf federal reserve ron paul roman empire ordo ab chao freemaso Sun, 01 Jan 2012 10:54:29 +0000 3/11, fukushima, earthquake, japan, southern, pacific, island, dollar, japan-china, nwo, haarp, nuclear, knights, of, malta, city, of, london, vatican, jesuits, conspiracy, zionism, rothschild, new, world, order, usgs, esf, federal, reserve, ron, paul, roman, empire, ordo, ab, chao, freemaso http://a.images.blip.tv/Craigoxley-JAPANHITWITH70EARTHQUAKEWARNINGBYCROWNMALTESEOVERUSDO961-54.jpg 3/11, fukushima, earthquake, japan, southern, pacific, island, dollar, japan-china, nwo, haarp, nuclear, knights, of, malta, city, of, london, vatican, jesuits, conspiracy, zionism, rothschild, new, world, order, usgs, esf, federal, reserve, ron, paul, roman, empire, ordo, ab, chao, freemaso ]]> JAPAN HIT WITH 7.0 EARTHQUAKE WARNING BY CROWN MALTESE OVER U.S. DOLLAR 44948D02-2DEB-11E1-A79B-B73ED79A8C2F http://blip.tv/the-unhived-mind/nike-air-jordan-limited-edition-riots-and-chaos-to-grab-sneakers-december-2011-5844878 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5844878 5827857 file TV-UN 0.0 2011-12-24T04:53:48Z English 0 0 0 101 AYLk33IC http://blip.tv/play/AYLk33IC http://blip.tv/comments/?attached_to=post5844878&skin=rss Craigoxley-NIKEAIRJORDANLIMITEDEDITIONRIOTSANDCHAOSTOGRABSNEAKERS921-177.jpg No license (All rights reserved)
The Third World United States reliant on consumerism to pay 70% of its Gross Domestic Product aided by Planned Obsolescence since the 1920s to aid the socially engineered Post Industrial Zero Growth Society. Consumers should be ashamed of themselves for even wanting to waste their worthless IOU fraudulent (according to the Constitution of the real united States of America [until 1861]) debt currency on such Chinese mass produced slave labor trash. All whilst the U.S. suffers in an engineered DEPRESSION and soon engineered ECONOMIC COLLAPSE so my advise is get out of the Cities (Zoos) as quick as possible. What will socially engineered sheep citizens like this do when theres no food and no welfare when the U.S. defaults maybe as early as August-November 2012? ]]> YahooPartnerVideoID Blip post id 5844878 http://blip.tv/file/5827857 Educational sneakers air jordan trainers shoes air jordan riots rioting looting nike carolina place mall north carolina police officers restore order air jordan 11 retro concords retro concords collectors new world order economic collapse depression bob chapman peter Sat, 24 Dec 2011 04:53:48 +0000 sneakers, air, jordan, trainers, shoes, air, jordan, riots, rioting, looting, nike, carolina, place, mall, north, carolina, police, officers, restore, order, air, jordan, 11, retro, concords, retro, concords, collectors, new, world, order, economic, collapse, depression, bob, chapman, peter http://a.images.blip.tv/Craigoxley-NIKEAIRJORDANLIMITEDEDITIONRIOTSANDCHAOSTOGRABSNEAKERS921-177.jpg sneakers, air, jordan, trainers, shoes, air, jordan, riots, rioting, looting, nike, carolina, place, mall, north, carolina, police, officers, restore, order, air, jordan, 11, retro, concords, retro, concords, collectors, new, world, order, economic, collapse, depression, bob, chapman, peter ]]> NIKE AIR JORDAN LIMITED EDITION RIOTS AND CHAOS TO GRAB SNEAKERS DECEMBER 2011 972AD42E-26C8-11E1-AAC5-8BECA11A50D7 http://blip.tv/the-unhived-mind/bob-chapman-14th-december-2011-financial-survival-with-melody-5823858 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5823858 5806825 file TV-UN 0.0 2011-12-15T02:57:57Z English 0 0 0 2931 AYLju1YC http://blip.tv/play/AYLju1YC http://blip.tv/comments/?attached_to=post5823858&skin=rss Craigoxley-BobChapman14thDecember2011FinancialSurvivalWithMelody689-188.jpg No license (All rights reserved)
Listen to Bob Chapman and Melody Cedarstrom on the Financial Survival radio show broadcast on the 14th of December 2011. http://vimeo.com/33700312 http://www.wwfar.com/microstats.html ]]> YahooPartnerVideoID Blip post id 5823858 http://blip.tv/file/5806825 Art commodity commodities bullion physical gold silver franc mark mining markets dow ftse economy economic depression recession recovery credit crunch social security medicare foreclosure default bankruptcy marines morgan shorts federal reserve imf cia foreca Thu, 15 Dec 2011 02:57:57 +0000 commodity, commodities, bullion, physical, gold, silver, franc, mark, mining, markets, dow, ftse, economy, economic, depression, recession, recovery, credit, crunch, social, security, medicare, foreclosure, default, bankruptcy, marines, morgan, shorts, federal, reserve, imf, cia, foreca http://a.images.blip.tv/Craigoxley-BobChapman14thDecember2011FinancialSurvivalWithMelody689-188.jpg commodity, commodities, bullion, physical, gold, silver, franc, mark, mining, markets, dow, ftse, economy, economic, depression, recession, recovery, credit, crunch, social, security, medicare, foreclosure, default, bankruptcy, marines, morgan, shorts, federal, reserve, imf, cia, foreca ]]> Bob Chapman - 14th December 2011 - Financial Survival with Melody EDFF0816-2861-11E1-BB28-D04345464ABC http://blip.tv/the-unhived-mind/uhm-its-all-lies-that-the-u-k-is-christian-5829606 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5829606 5812574 file TV-UN 0.0 2011-12-17T03:48:06Z English 0 0 0 712 AYLj6EoC http://blip.tv/play/AYLj6EoC http://blip.tv/comments/?attached_to=post5829606&skin=rss Craigoxley-UHMITSALLLIESTHATTHEUKISCHRISTIAN964-272.jpg No license (All rights reserved)
David Cameron lies out of his front teeth yet again to a low intelligence populace who suck up the propaganda and believe illusions ]]> YahooPartnerVideoID Blip post id 5829606 http://blip.tv/file/5812574 Educational cameron christian united kingdom jesuits nwo new world order jesuitism jesuit order templar malta knights vatican sovereignty bankruptcy truth conspiracy Sat, 17 Dec 2011 03:48:06 +0000 cameron christian united kingdom jesuits nwo new world order jesuitism jesuit order templar malta knights vatican sovereignty bankruptcy, truth, conspiracy http://a.images.blip.tv/Craigoxley-UHMITSALLLIESTHATTHEUKISCHRISTIAN964-272.jpg cameron christian united kingdom jesuits nwo new world order jesuitism jesuit order templar malta knights vatican sovereignty bankruptcy, truth, conspiracy ]]> UHM - ITS ALL LIES THAT THE U.K. IS CHRISTIAN 9DA0CEF0-1F0F-11E1-8720-9593AD9D71F3 http://blip.tv/the-unhived-mind/dr-bill-deagle-2nd-dec-2011-earth-preparedness-hour-5793550 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5793550 5776503 file TV-UN 0.0 2011-12-05T07:06:12Z English 0 0 0 2316 AYLhznIC http://blip.tv/play/AYLhznIC http://blip.tv/comments/?attached_to=post5793550&skin=rss Craigoxley-DrBillDeagle2ndDec2011EarthPreparednessHour687-345.jpg No license (All rights reserved)
Listen to Dr Bill Deagle, John Moore, Ann Morrison and Robert Felix on the Earth Preparedness Hour of the Nutrimedical Report from the 2nd of December 2011 ]]> YahooPartnerVideoID Blip post id 5793550 http://blip.tv/file/5776503 Educational bill deagle earth preparedness house ann morrison john moore robert felix nutrimedical report ice-age flooding tsunami disaster survival prepping preppers Mon, 05 Dec 2011 07:06:12 +0000 bill, deagle, earth, preparedness, house, ann, morrison, john, moore, robert, felix, nutrimedical, report, ice-age, flooding, tsunami, disaster, survival, prepping, preppers http://a.images.blip.tv/Craigoxley-DrBillDeagle2ndDec2011EarthPreparednessHour687-345.jpg bill, deagle, earth, preparedness, house, ann, morrison, john, moore, robert, felix, nutrimedical, report, ice-age, flooding, tsunami, disaster, survival, prepping, preppers ]]> Dr Bill Deagle – 2nd Dec 2011 – Earth Preparedness Hour 9169FB56-1E4D-11E1-8B6C-8AB61A0D744C http://blip.tv/the-unhived-mind/the-hidden-desmarais-family-and-the-hidden-hand-power-5791473 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5791473 5774426 file TV-UN 0.0 2011-12-04T07:57:09Z English 0 0 0 397 AYLhvlUC http://blip.tv/play/AYLhvlUC http://blip.tv/comments/?attached_to=post5791473&skin=rss Craigoxley-TheHiddenDesmaraisFamilyAndTheHiddenHandPower385-777.jpg No license (All rights reserved)
Take note of the true power of the World and another hidden financier family working for the Roman Empire Link http://theunhivedmind.com/wordpress/?p=13751 ]]> YahooPartnerVideoID Blip post id 5791473 http://blip.tv/file/5774426 Educational roman empire nwo new world order conspiracy illuminati truth bankers banksters rothschild zionism zionist desmarais pope vatican jesuits jesuit order freemasonry city london crown bar privy council assassination Sun, 04 Dec 2011 07:57:09 +0000 roman, empire, nwo, new, world, order, conspiracy, illuminati, truth, bankers, banksters, rothschild, zionism, zionist, desmarais, pope, vatican, jesuits, jesuit, order, freemasonry, city, london, crown, bar, privy, council, assassination http://a.images.blip.tv/Craigoxley-TheHiddenDesmaraisFamilyAndTheHiddenHandPower385-777.jpg roman, empire, nwo, new, world, order, conspiracy, illuminati, truth, bankers, banksters, rothschild, zionism, zionist, desmarais, pope, vatican, jesuits, jesuit, order, freemasonry, city, london, crown, bar, privy, council, assassination ]]> The Hidden Desmarais family and the Hidden Hand Power 31E0BAC4-1D5A-11E1-80EF-EF1719BB0739 http://blip.tv/the-unhived-mind/dr-bill-deagle-2nd-dec-2011-earth-preparedness-hour-5789086 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5789086 5772039 file TV-UN 0.0 2011-12-03T02:55:01Z English 0 0 0 2316 AYLhrAIC http://blip.tv/play/AYLhrAIC http://blip.tv/comments/?attached_to=post5789086&skin=rss Craigoxley-DrBillDeagle2ndDec2011EarthPreparednessHour523-350.jpg No license (All rights reserved)
Listen to Bill Deagle, J.R Moore and Ann Morrison host the Earth Preparedness Hour for December 2nd 2011. ]]> YahooPartnerVideoID Blip post id 5789086 http://blip.tv/file/5772039 Educational mexico drug cartel cia marines earth preparedness hour nutrimedical report bill deagle john moore nuclear radiation earthquakes volcano storm gulf bird flu swine h1n1 h5n1 nwo order illuminati alex jones katrina crown fukushima japan tsunami knights malta Sat, 03 Dec 2011 02:55:01 +0000 mexico, drug, cartel, cia, marines, earth, preparedness, hour, nutrimedical, report, bill, deagle, john, moore, nuclear, radiation, earthquakes, volcano, storm, gulf, bird, flu, swine, h1n1, h5n1, nwo, order, illuminati, alex, jones, katrina, crown, fukushima, japan, tsunami, knights, malta http://a.images.blip.tv/Craigoxley-DrBillDeagle2ndDec2011EarthPreparednessHour523-350.jpg mexico, drug, cartel, cia, marines, earth, preparedness, hour, nutrimedical, report, bill, deagle, john, moore, nuclear, radiation, earthquakes, volcano, storm, gulf, bird, flu, swine, h1n1, h5n1, nwo, order, illuminati, alex, jones, katrina, crown, fukushima, japan, tsunami, knights, malta ]]> Dr Bill Deagle - 2nd Dec 2011 - Earth Preparedness Hour 387ABB00-1D46-11E1-965B-AB667604AD64 http://blip.tv/the-unhived-mind/bob-chapman-2nd-december-2011-financial-survival-with-melody-5788860 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5788860 5771813 file TV-UN 0.0 2011-12-03T00:32:03Z English 0 0 0 2876 AYLhqiAC http://blip.tv/play/AYLhqiAC http://blip.tv/comments/?attached_to=post5788860&skin=rss Craigoxley-BobChapman2ndDecember2011FinancialSurvivalWithMelody923-248.jpg No license (All rights reserved)
Listen to Robert Chapman and Melody Cedarstrom about current economic, politics and bullion tradings. ]]> YahooPartnerVideoID Blip post id 5788860 http://blip.tv/file/5771813 Educational bob chapman chapman robert chapman the international forecaster international forecaster nwo new world order financial survival melody cedarstrom economics politics bullion gold silver depression illuminati conspiracy Sat, 03 Dec 2011 00:32:03 +0000 bob chapman, chapman, robert chapman, the international forecaster, international forecaster, nwo, new world order, financial survival, melody cedarstrom, economics, politics, bullion, gold, silver, depression, illuminati, conspiracy http://a.images.blip.tv/Craigoxley-BobChapman2ndDecember2011FinancialSurvivalWithMelody923-248.jpg bob chapman, chapman, robert chapman, the international forecaster, international forecaster, nwo, new world order, financial survival, melody cedarstrom, economics, politics, bullion, gold, silver, depression, illuminati, conspiracy ]]> Bob Chapman - 2nd December 2011 - Financial Survival with Melody 35E50698-1A5D-11E1-84DF-C0AB43BD1F82 http://blip.tv/the-unhived-mind/the-roman-empire-behind-prince-william-5776743 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5776743 5759689 file TV-UN 0.0 2011-11-29T07:39:03Z English 0 0 0 219 AYLgy0sC http://blip.tv/play/AYLgy0sC http://blip.tv/comments/?attached_to=post5776743&skin=rss Craigoxley-THEROMANEMPIREBEHINDPRINCEWILLIAM613-64.jpg No license (All rights reserved)
William Windsor has Roman Empire bloodline and is he's a level of the revived Holy Roman Empire controlled by Aragon Knights Templar. http://www.youtube.com/watch?v=wq9KfQby0Mc ]]> YahooPartnerVideoID Blip post id 5776743 http://blip.tv/file/5759689 Educational sforza roman empire windsor royal queen prince william middleton bloodlines templar medici princess diana vatican jesuits nwo new world order illuminati conspiracy Tue, 29 Nov 2011 07:39:03 +0000 sforza, roman, empire, windsor, royal, queen, prince, william, middleton, bloodlines, templar, medici, princess, diana, vatican, jesuits, nwo, new, world, order, illuminati, conspiracy http://a.images.blip.tv/Craigoxley-THEROMANEMPIREBEHINDPRINCEWILLIAM613-64.jpg sforza, roman, empire, windsor, royal, queen, prince, william, middleton, bloodlines, templar, medici, princess, diana, vatican, jesuits, nwo, new, world, order, illuminati, conspiracy ]]> THE ROMAN EMPIRE BEHIND PRINCE WILLIAM 684BED52-1A5A-11E1-9F90-E5A1362CDDD7 http://blip.tv/the-unhived-mind/bob-chapman-speaks-briefly-on-the-pallavicini-family-5776716 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5776716 5759662 file TV-UN 0.0 2011-11-29T07:18:59Z English 0 0 0 182 AYLgyzAC http://blip.tv/play/AYLgyzAC http://blip.tv/comments/?attached_to=post5776716&skin=rss Craigoxley-BOBCHAPMANSPEAKSBRIEFLYONTHEPALLAVICINIFAMILY736-746.jpg No license (All rights reserved)
Finally someone else has spoken about the Pallavicini with a little prodding other than The Unhived Mind. Welcome to another family you didn't know existed and has far greater power than the Rothschild. The question was asked by The Unhived Mind via the chatroom and asked by Drew. Remember that Giancarlo Pallavicini headed the Knights of Malta in the year of 1988 as a Lieutenant prior to Andrew Willoughby Ninian Bertie becoming GrandMaster of the Order. http://www.youtube.com/watch?v=aGqdMSPDmvc http://vimeo.com/32831565 ]]> YahooPartnerVideoID Blip post id 5776716 http://blip.tv/file/5759662 Educational pallavicini pallavicino bob chapman marines disquisition nwo new world order illuminati conspiracy bloodlines fondi bankers survival Tue, 29 Nov 2011 07:18:59 +0000 pallavicini, pallavicino, bob, chapman, marines, disquisition, nwo, new, world, order, illuminati, conspiracy, bloodlines, fondi, bankers, survival http://a.images.blip.tv/Craigoxley-BOBCHAPMANSPEAKSBRIEFLYONTHEPALLAVICINIFAMILY736-746.jpg pallavicini, pallavicino, bob, chapman, marines, disquisition, nwo, new, world, order, illuminati, conspiracy, bloodlines, fondi, bankers, survival ]]> BOB CHAPMAN SPEAKS BRIEFLY ON THE PALLAVICINI FAMILY 8CFCA6F6-1A59-11E1-A197-AD290466AA48 http://blip.tv/the-unhived-mind/pallavicini-cousin-sends-death-threats-to-craig-oxley-5776708 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5776708 5759654 file TV-UN 0.0 2011-11-29T07:12:51Z English 0 0 0 177 AYLgyygC http://blip.tv/play/AYLgyygC http://blip.tv/comments/?attached_to=post5776708&skin=rss Craigoxley-PALLAVICINICOUSINSENDSDEATHTHREATSTOCRAIGOXLEY351-977.jpg No license (All rights reserved)
Exposure of the Pallavicini family is not wanted it shall seem and this is why death threats get thrown around. The Pallavicini are far more powerful than the Rothschild family everyone knows of. youtube.com/watch?v=UE6sKXvY3xM BOB CHAPMAN SPEAKS BRIEFLY ON THE PALLAVICINI FAMILY: youtube.com/watch?v=aGqdMSPDmvc Threats: theunhivedmind.com/wordpress/?p=11394 ]]> YahooPartnerVideoID Blip post id 5776708 http://blip.tv/file/5759654 Educational pallavicini pallavicino vittorio vivaldi vvviii venice count san rocco nwo new world order illuminati assassinati death threat bankers fondi bloodlines roman empire Tue, 29 Nov 2011 07:12:51 +0000 pallavicini, pallavicino, vittorio, vivaldi, vvviii, venice, count, san, rocco, nwo, new, world, order, illuminati, assassinati, death, threat, bankers, fondi, bloodlines, roman, empire http://a.images.blip.tv/Craigoxley-PALLAVICINICOUSINSENDSDEATHTHREATSTOCRAIGOXLEY351-977.jpg pallavicini, pallavicino, vittorio, vivaldi, vvviii, venice, count, san, rocco, nwo, new, world, order, illuminati, assassinati, death, threat, bankers, fondi, bloodlines, roman, empire ]]> PALLAVICINI COUSIN SENDS DEATH THREATS TO CRAIG OXLEY 05D7512A-1A55-11E1-9358-86AE32CDF599 http://blip.tv/the-unhived-mind/bob-chapman-28th-nov-2011-financial-survival-w-melody-5776671 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5776671 5759617 file TV-UN 0.0 2011-11-29T06:40:27Z English 0 0 0 2999 AYLgywMC http://blip.tv/play/AYLgywMC http://blip.tv/comments/?attached_to=post5776671&skin=rss Craigoxley-BobChapman28thNov2011FinancialSurvivalWMelody273-974.jpg No license (All rights reserved)
Listen to Bob Chapman and Melody Cedarstrom on the Financial Survival radio show broadcast on the 28th of November 2011. http://www.wwfar.com/microstats.html ]]> YahooPartnerVideoID Blip post id 5776671 http://blip.tv/file/5759617 Educational bob chapman financial survival melody cedarstrom gold silver trading stock markets stocks wealth investment survival precious metals depression recession Tue, 29 Nov 2011 06:40:27 +0000 bob, chapman, financial, survival, melody, cedarstrom, gold, silver, trading, stock, markets, stocks, wealth, investment, survival, precious, metals, depression, recession http://a.images.blip.tv/Craigoxley-BobChapman28thNov2011FinancialSurvivalWMelody273-974.jpg bob, chapman, financial, survival, melody, cedarstrom, gold, silver, trading, stock, markets, stocks, wealth, investment, survival, precious, metals, depression, recession ]]> Bob Chapman - 28th Nov 2011 - Financial Survival w/ Melody E37744EE-1A51-11E1-B1B9-D6B11283C071 http://blip.tv/the-unhived-mind/u-k-becomes-a-nazi-workfare-slave-camp-for-unum-5776634 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5776634 5759580 file TV-UN 0.0 2011-11-29T06:18:00Z English 0 0 0 180 AYLgyl4C http://blip.tv/play/AYLgyl4C http://blip.tv/comments/?attached_to=post5776634&skin=rss Craigoxley-UKBECOMESANAZIWORKFARESLAVECAMPFORUNUM221-567.jpg No license (All rights reserved)
The United Kingdom corporate vessel is taking your rights away from you by the day and turning the corporation into a Stasi hell hole. Its time to bring the nation of England back and a love for our sovereign nation. All these organisations, politicians and those who follow them are committing TREASON on England and will be punished for the crime shortly. http://www.youtube.com/watch?v=kOfPF_w4HEE Benefit Sanctions JSA Three Strikes and You're Out http://www.youtube.com/watch?v=nkh-hYNDNHU BELOW IS REALLY THE START READY FOR 2013: Ken Clarke hopeful of deal on European human rights laws http://theunhivedmind.com/wordpress/?p=11420 ITS TIME FOLKS TO GET INVOLVED WITH THE BRITISH CONSTITUTIONAL GROUP AND LAWFUL REBELLION. WE NEED TO TAKE THIS COUNTRY BACK QUICKLY. ]]> YahooPartnerVideoID Blip post id 5776634 http://blip.tv/file/5759580 Educational unum provident dwp unemployed job losses layoffs nwo illuminati nazi atos health sickness assessment Tue, 29 Nov 2011 06:18:00 +0000 unum, provident, dwp, unemployed, job, losses, layoffs, nwo, illuminati, nazi, atos, health, sickness, assessment http://a.images.blip.tv/Craigoxley-UKBECOMESANAZIWORKFARESLAVECAMPFORUNUM221-567.jpg unum, provident, dwp, unemployed, job, losses, layoffs, nwo, illuminati, nazi, atos, health, sickness, assessment ]]> U.K. BECOMES A NAZI WORKFARE SLAVE CAMP FOR UNUM F29423C6-1A50-11E1-B1D0-A9507935AE15 http://blip.tv/the-unhived-mind/city-of-london-puppet-to-meet-his-germs-of-syria-5776628 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5776628 5759574 file TV-UN 0.0 2011-11-29T06:11:16Z English 0 0 0 275 AYLgylgC http://blip.tv/play/AYLgylgC http://blip.tv/comments/?attached_to=post5776628&skin=rss Craigoxley-CITYOFLONDONPUPPETTOMEETHISGERMSOFSYRIA235-255.jpg No license (All rights reserved)
Front puppets of the City of London Corporation act as if they rule the World but rule nothing without the say of the Crown Bar who really rules the roost by proxy for the HOLY SEE! http://www.youtube.com/watch?v=7bLZrFCp52k http://www.youtube.com/watch?v=jHTM7Y_b1MQ Foreign Libyan Journalist's Confessions on REAL Libya and Gadaffi http://www.youtube.com/watch?v=3XGWPBvmVPo ]]> YahooPartnerVideoID Blip post id 5776628 http://blip.tv/file/5759574 Educational city london puppet germs hague syria syria war conflict middle east al-assad assad germs revolution uprising military gaddafi libya Tue, 29 Nov 2011 06:11:16 +0000 city, london, puppet, germs, hague, syria, syria, war, conflict, middle, east, al-assad, assad, germs, revolution, uprising, military, gaddafi, libya http://a.images.blip.tv/Craigoxley-CITYOFLONDONPUPPETTOMEETHISGERMSOFSYRIA235-255.jpg city, london, puppet, germs, hague, syria, syria, war, conflict, middle, east, al-assad, assad, germs, revolution, uprising, military, gaddafi, libya ]]> CITY OF LONDON PUPPET TO MEET HIS GERMS OF SYRIA B40320CC-1A4F-11E1-B43E-8480D4600BCC http://blip.tv/the-unhived-mind/bob-chapman-17-nov-2011-a-marines-disquisition-5776613 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5776613 5759559 file TV-UN 0.0 2011-11-29T06:02:22Z English 0 0 0 3089 AYLgykkC http://blip.tv/play/AYLgykkC http://blip.tv/comments/?attached_to=post5776613&skin=rss Craigoxley-BOBCHAPMAN17NOV2011AMARINESDISQUISITION382-563.jpg No license (All rights reserved)
This broadcast took place on the 17th of November 2011 by Drew Malone Raines III on the A Marines Disquisition show "The Financial Hour" with Bob Chapman,"The International Forecaster" who enlightens us with the full investigative truth of the financial world much of which is distatched from his personal knowledge and friends from around the world. Mr. Chapman is the MOST Pledgerized Financial Advisor from around the world. Parts 1-4: http://www.youtube.com/watch?v=z8_GV6zaBG8 http://www.youtube.com/watch?v=fDMC9qP56fU http://www.youtube.com/watch?v=-x_K5CtcK34 http://www.youtube.com/watch?v=fdlDpowc8Ho http://vimeo.com/32490095 ]]> YahooPartnerVideoID Blip post id 5776613 http://blip.tv/file/5759559 Educational nwo new world order marines disquisition bob chapman economy economic financial gold silver bullion gld slv stock markets fisal bullion forecaster melody cedarstrom illuminati Tue, 29 Nov 2011 06:02:22 +0000 nwo new world order marines disquisition bob chapman economy economic financial gold silver bullion gld slv stock markets fisal bullion forecaster melody cedarstrom, illuminati http://a.images.blip.tv/Craigoxley-BOBCHAPMAN17NOV2011AMARINESDISQUISITION382-563.jpg nwo new world order marines disquisition bob chapman economy economic financial gold silver bullion gld slv stock markets fisal bullion forecaster melody cedarstrom, illuminati ]]> BOB CHAPMAN - 17 NOV 2011 - A MARINES DISQUISITION B496E840-1A4D-11E1-9020-E8DE7CB4D695 http://blip.tv/the-unhived-mind/ann-morrison-robert-felix-nov-18-2011-america-s-rivers-are-slowing-5776594 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5776594 5759540 file TV-UN 0.0 2011-11-29T05:48:04Z English 0 0 0 2234 AYLgyjYC http://blip.tv/play/AYLgyjYC http://blip.tv/comments/?attached_to=post5776594&skin=rss Craigoxley-AnnMorrisonRobertFelixNov182011AmericasRiversAreSlo786-78.jpg No license (All rights reserved)
Listen to Ann Morrison host the Earth Preparedness Hour for November 18th 2011 with guest Robert Felix. This was a good show without Dr Bill 'interrupt' Deagle spoiling it. Parts 1-3: http://www.youtube.com/watch?v=DuVxl4R-rhk http://www.youtube.com/watch?v=DvH85haU_BI http://www.youtube.com/watch?v=Da6Fgs5r8-E http://vimeo.com/32491339 ]]> YahooPartnerVideoID Blip post id 5776594 http://blip.tv/file/5759540 Educational dr deagle felix ice-age rivers mississippi missouri lowing dreaging morrison oil gulf mexico deepwater horizon bp british petroleum goods china slowing Tue, 29 Nov 2011 05:48:04 +0000 dr, deagle, felix, ice-age, rivers, mississippi, missouri, lowing, dreaging, morrison, oil, gulf, mexico, deepwater, horizon, bp, british, petroleum, goods, china, slowing http://a.images.blip.tv/Craigoxley-AnnMorrisonRobertFelixNov182011AmericasRiversAreSlo786-78.jpg dr, deagle, felix, ice-age, rivers, mississippi, missouri, lowing, dreaging, morrison, oil, gulf, mexico, deepwater, horizon, bp, british, petroleum, goods, china, slowing ]]> Ann Morrison & Robert Felix - Nov 18 2011 - America's rivers are slowing 80E36F6A-1A4C-11E1-BFF6-C7646A1DE4EC http://blip.tv/the-unhived-mind/bob-chapman-21st-nov-2011-financial-survival-w-melody-5776584 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5776584 5759530 file TV-UN 0.0 2011-11-29T05:39:28Z English 0 0 0 2931 AYLgyiwC http://blip.tv/play/AYLgyiwC http://blip.tv/comments/?attached_to=post5776584&skin=rss Craigoxley-BobChapman21stNov2011FinancialSurvivalWMelody976-638.jpg No license (All rights reserved)
Listen to Bob Chapman and Melody Cedarstrom on the Financial Survival radio show broadcast on the 21st of November 2011. Parts 1-4: http://www.youtube.com/watch?v=wB6rSXlNgaA http://www.youtube.com/watch?v=SmFvVF8xIC0 http://www.youtube.com/watch?v=XXmNarfU8Rs http://www.youtube.com/watch?v=b9F1wkxDtrc http://vimeo.com/32495407 http://www.wwfar.com/microstats.html ]]> YahooPartnerVideoID Blip post id 5776584 http://blip.tv/file/5759530 Educational bob chapman melody cedarstrom gold silver bullion metal wealth investment depression recession collapse economy financial survival Tue, 29 Nov 2011 05:39:28 +0000 bob, chapman, melody, cedarstrom, gold, silver, bullion, metal, wealth, investment, depression, recession, collapse, economy, financial, survival http://a.images.blip.tv/Craigoxley-BobChapman21stNov2011FinancialSurvivalWMelody976-638.jpg bob, chapman, melody, cedarstrom, gold, silver, bullion, metal, wealth, investment, depression, recession, collapse, economy, financial, survival ]]> Bob Chapman - 21st Nov 2011 - Financial Survival w/ Melody FE8BE066-1A4A-11E1-AC9B-BBEA9605C36B http://blip.tv/the-unhived-mind/alfred-adask-18-nov-2011-the-fictional-person-5776569 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5776569 5759515 file TV-UN 0.0 2011-11-29T05:28:39Z English 0 0 0 1455 AYLgyh0C http://blip.tv/play/AYLgyh0C http://blip.tv/comments/?attached_to=post5776569&skin=rss Craigoxley-AlfredAdask18Nov2011TheFictionalPerson136-479.jpg No license (All rights reserved)
Listen to Alfred Adask speak again on the fictional person controlling you today. This show was broadcast on the 18th November 2011. Parts 1-2: youtube.com/watch?v=eBzHr79MZyI youtube.com/watch?v=PXSvYJ2VADY http://vimeo.com/32496353 ]]> YahooPartnerVideoID Blip post id 5776569 http://blip.tv/file/5759515 Educational fictional corporation sovereign freeman admiralty common law freedom rights liberty bible god constitution commerce Tue, 29 Nov 2011 05:28:39 +0000 fictional, corporation, sovereign, freeman, admiralty, common, law, freedom, rights, liberty, bible, god, constitution, commerce http://a.images.blip.tv/Craigoxley-AlfredAdask18Nov2011TheFictionalPerson136-479.jpg fictional, corporation, sovereign, freeman, admiralty, common, law, freedom, rights, liberty, bible, god, constitution, commerce ]]> Alfred Adask - 18 Nov 2011 - The Fictional Person B4DA7334-1A49-11E1-8C24-F8022B956C12 http://blip.tv/the-unhived-mind/webster-tarpley-26-nov-2011-more-truth-on-syria-5776551 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5776551 5759497 file TV-UN 0.0 2011-11-29T05:19:26Z English 0 0 0 4377 AYLgygsC http://blip.tv/play/AYLgygsC http://blip.tv/comments/?attached_to=post5776551&skin=rss Craigoxley-WebsterTarpley26Nov2011MoreTruthOnSyria491-725.jpg No license (All rights reserved)
Listen to Webster Tarpley on World Crisis Radio broadcast on November 26th 2011 live from Beirut, Lebanon. More on the frauds of the Western media against Syria. Parts 1-5: http://www.youtube.com/watch?v=JlxeA-3pwG0 http://www.youtube.com/watch?v=ITsq27h3E_w http://www.youtube.com/watch?v=tTbN9nCCCA0 http://www.youtube.com/watch?v=JClk8YjNsyA http://www.youtube.com/watch?v=L5meXILzffI http://vimeo.com/32769466 ]]> YahooPartnerVideoID Blip post id 5776551 http://blip.tv/file/5759497 Educational debt ceiling depression recession credit crunch nasa derivative tax shuttle barack obama tea party koch brothers color revolution constitution bill rights freedom truth conspiracy economy bankrupt bankruptcy foreclosure default 9/11 911 wtc7 nwo order ale Tue, 29 Nov 2011 05:19:26 +0000 debt, ceiling, depression, recession, credit, crunch, nasa, derivative, tax, shuttle, barack, obama, tea, party, koch, brothers, color, revolution, constitution, bill, rights, freedom, truth, conspiracy, economy, bankrupt, bankruptcy, foreclosure, default, 9/11, 911, wtc7, nwo, order, ale http://a.images.blip.tv/Craigoxley-WebsterTarpley26Nov2011MoreTruthOnSyria491-725.jpg debt, ceiling, depression, recession, credit, crunch, nasa, derivative, tax, shuttle, barack, obama, tea, party, koch, brothers, color, revolution, constitution, bill, rights, freedom, truth, conspiracy, economy, bankrupt, bankruptcy, foreclosure, default, 9/11, 911, wtc7, nwo, order, ale ]]> Webster Tarpley - 26 Nov 2011 - More truth on Syria 979AFE6A-1A44-11E1-9AFC-89F55E176EB1 http://blip.tv/the-unhived-mind/dr-bill-deagle-willa-london-25-nov-2011-abortions-for-un-agenda-21-5776497 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5776497 5759443 file TV-UN 0.0 2011-11-29T04:42:50Z English 0 0 0 2256 AYLgyVUC http://blip.tv/play/AYLgyVUC http://blip.tv/comments/?attached_to=post5776497&skin=rss Craigoxley-DrBillDeagleWillaLondon25Nov2011AbortionsForUNAgen792-826.jpg No license (All rights reserved)
Listen to Dr Bill Deagle and Willa London on abortions and the population reduction agenda all tied to the U.N Agenda 21 aka Sustainable Development. This broadcast took place on the 25th November 2011. http://vimeo.com/32767066 youtube.com/watch?v=Npk5Ww9On2w youtube.com/watch?v=C0ax0Ql-aaQ youtube.com/watch?v=bXDmR6FDdI8 ]]> YahooPartnerVideoID Blip post id 5776497 http://blip.tv/file/5759443 Educational abiotic aborted abortion alex jones bible bill bird flu birth control cartel cia cme constitution contraception coronal crown crude cytokine deagle death panels disabled drug earth earthquakes ejection energy faraday fbi floods freedom freemasonry fukushi Tue, 29 Nov 2011 04:42:50 +0000 abiotic, aborted, abortion, alex jones, bible, bill, bird flu, birth control, cartel, cia, cme, constitution, contraception, coronal, crown, crude, cytokine, deagle, death panels, disabled, drug, earth, earthquakes, ejection, energy, faraday, fbi, floods, freedom, freemasonry, fukushi http://a.images.blip.tv/Craigoxley-DrBillDeagleWillaLondon25Nov2011AbortionsForUNAgen792-826.jpg abiotic, aborted, abortion, alex jones, bible, bill, bird flu, birth control, cartel, cia, cme, constitution, contraception, coronal, crown, crude, cytokine, deagle, death panels, disabled, drug, earth, earthquakes, ejection, energy, faraday, fbi, floods, freedom, freemasonry, fukushi ]]> Dr Bill Deagle & Willa London – 25 Nov 2011 – Abortions for UN Agenda 21 0F101604-1187-11E1-82B6-EEF3009B68CC http://blip.tv/the-unhived-mind/dope-inc-wants-you-junkies-during-the-pizgs-5746168 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5746168 5729106 file TV-UN 0.0 2011-11-18T01:45:56Z English 0 0 0 92 AYLe3FwC http://blip.tv/play/AYLe3FwC http://blip.tv/comments/?attached_to=post5746168&skin=rss Craigoxley-DOPEINCWANTSYOUJUNKIESDURINGTHEPIZGS856-605.jpg No license (All rights reserved)
Dope Inc want you all high as a kite as you have no job in the Post Industrial Zero Growth Society bought about by a civilisation with an economic depression. No different to the attack on the Chinese with the Opium War. Remember the Russell and Astor families are big known Dope Inc opium traders and the later is directly connected to David Cameron who's connected with the HSBC through the Keswick and HSBC bank aka Ewen Cameron. ]]> YahooPartnerVideoID Blip post id 5746168 http://blip.tv/file/5729106 Educational dope dope inc apothecaries city of london beic british east india keswick hsbc nwo new world order jesuits vatican pope heroin cocaine bourbon heroin cocaine opium Fri, 18 Nov 2011 01:45:56 +0000 dope, dope, inc, apothecaries, city, of, london, beic, british, east, india, keswick, hsbc, nwo, new, world, order, jesuits, vatican, pope, heroin, cocaine, bourbon, heroin, cocaine, opium http://a.images.blip.tv/Craigoxley-DOPEINCWANTSYOUJUNKIESDURINGTHEPIZGS856-605.jpg dope, dope, inc, apothecaries, city, of, london, beic, british, east, india, keswick, hsbc, nwo, new, world, order, jesuits, vatican, pope, heroin, cocaine, bourbon, heroin, cocaine, opium ]]> DOPE INC WANTS YOU JUNKIES DURING THE PIZGS 7615CC8E-10E4-11E1-9E72-EC8D16D1C004 http://blip.tv/the-unhived-mind/the-percy-family-and-the-goldschmidt-connection-5743751 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5743751 5726684 file TV-UN 0.0 2011-11-17T06:22:01Z English 0 0 0 201 AYLeyWsC http://blip.tv/play/AYLeyWsC http://blip.tv/comments/?attached_to=post5743751&skin=rss Craigoxley-THEPERCYFAMILYANDTHEGOLDSCHMIDTCONNECTION850-126.jpg No license (All rights reserved)
You were told a union may come forth between these two families and its looking likely yet again. ]]> YahooPartnerVideoID Blip post id 5743751 http://blip.tv/file/5726684 Educational goldschmidt percy rothschild nwo new world order vatican catholic conspiracy illuminati bush druidic witchcraft freemasonry jesuits Thu, 17 Nov 2011 06:22:01 +0000 goldschmidt, percy, rothschild, nwo, new, world, order, vatican, catholic, conspiracy, illuminati, bush, druidic, witchcraft, freemasonry, jesuits http://a.images.blip.tv/Craigoxley-THEPERCYFAMILYANDTHEGOLDSCHMIDTCONNECTION850-126.jpg goldschmidt, percy, rothschild, nwo, new, world, order, vatican, catholic, conspiracy, illuminati, bush, druidic, witchcraft, freemasonry, jesuits ]]> THE PERCY FAMILY AND THE GOLDSCHMIDT CONNECTION F901EA76-10C4-11E1-AF37-99288A8B4FC3 http://blip.tv/the-unhived-mind/deception-at-the-king-james-bible-meeting-nov-2011-5743367 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5743367 5726300 file TV-UN 0.0 2011-11-17T02:36:37Z English 0 0 0 179 AYLexmsC http://blip.tv/play/AYLexmsC http://blip.tv/comments/?attached_to=post5743367&skin=rss Craigoxley-DECEPTIONATTHEKINGJAMESBIBLEMEETINGNOV2011383-67.jpg No license (All rights reserved)
There is deception at the highest levels of the Church of England which must be exposed. ]]> YahooPartnerVideoID Blip post id 5743367 http://blip.tv/file/5726300 Educational unhived mind church of england nwo new world order vatican jesuits city of london depopulation eugenics illuminati club of rome porritt charles population reduction deception king james bible Thu, 17 Nov 2011 02:36:37 +0000 unhived mind, church of england, nwo, new world order, vatican, jesuits, city of london, depopulation, eugenics, illuminati, club of rome, porritt, charles, population reduction, deception, king james bible http://a.images.blip.tv/Craigoxley-DECEPTIONATTHEKINGJAMESBIBLEMEETINGNOV2011383-67.jpg unhived mind, church of england, nwo, new world order, vatican, jesuits, city of london, depopulation, eugenics, illuminati, club of rome, porritt, charles, population reduction, deception, king james bible ]]> DECEPTION AT THE KING JAMES BIBLE MEETING NOV 2011 2E9D7062-0FEC-11E1-A21F-ED68C6C7CA74 http://blip.tv/the-unhived-mind/was-llya-zhitomirskiy-the-co-founder-of-diaspora-assassinated-5739404 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5739404 5722336 file TV-UN 0.0 2011-11-16T00:44:46Z English 0 0 0 180 AYLep3AC http://blip.tv/play/AYLep3AC http://blip.tv/comments/?attached_to=post5739404&skin=rss Craigoxley-WASLLYAZHITOMIRSKIYTHECOFOUNDEROFDIASPORAASSASSINATED310-299.jpg No license (All rights reserved)
Are the real controllers of a certain social network ready for competition and privacy which defeats their real goals for their social network baby? I think not! ]]> YahooPartnerVideoID Blip post id 5739404 http://blip.tv/file/5722336 Educational diaspora assassination murder suicide llya zhitomirskiy social network facebook privacy big brother orwell nwo new world order city of london jesuits vatican knights of malta patent pools bill gates ttl tracking surveillance tagging locating Wed, 16 Nov 2011 00:44:46 +0000 diaspora, assassination, murder, suicide, llya, zhitomirskiy, social, network, facebook, privacy, big, brother, orwell, nwo, new, world, order, city, of, london, jesuits, vatican, knights, of, malta, patent, pools, bill, gates, ttl, tracking, surveillance, tagging, locating http://a.images.blip.tv/Craigoxley-WASLLYAZHITOMIRSKIYTHECOFOUNDEROFDIASPORAASSASSINATED310-299.jpg diaspora, assassination, murder, suicide, llya, zhitomirskiy, social, network, facebook, privacy, big, brother, orwell, nwo, new, world, order, city, of, london, jesuits, vatican, knights, of, malta, patent, pools, bill, gates, ttl, tracking, surveillance, tagging, locating ]]> WAS LLYA ZHITOMIRSKIY THE CO-FOUNDER OF DIASPORA ASSASSINATED? 4A371BB8-0FEA-11E1-B971-C9D5A897B733 http://blip.tv/the-unhived-mind/emperor-carlos-uses-turkey-to-threaten-syrian-with-genocide-5739385 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5739385 5722317 file TV-UN 0.0 2011-11-16T00:31:14Z English 0 0 0 280 AYLep10C http://blip.tv/play/AYLep10C http://blip.tv/comments/?attached_to=post5739385&skin=rss Craigoxley-EMPERORCARLOSUSESTURKEYTOTHREATENSYRIANWITHGENOCIDE681-956.jpg No license (All rights reserved)
The Turkish arm of the Roman Empire does the bidding of its master in Spain in attacking Syria in order to bring about the next phase towards the destruction of Israel and Islam in one ]]> YahooPartnerVideoID Blip post id 5739385 http://blip.tv/file/5722317 Educational uhm syria syrian turkey turkish ww3 world war ufm union for the mediterranean roman empire electricity nwo new world order pope jesuits crusade al-assad libya gaddafi Wed, 16 Nov 2011 00:31:14 +0000 uhm, syria, syrian, turkey, turkish, ww3, world, war, ufm, union, for, the, mediterranean, roman, empire, electricity, nwo, new, world, order, pope, jesuits, crusade, al-assad, libya, gaddafi http://a.images.blip.tv/Craigoxley-EMPERORCARLOSUSESTURKEYTOTHREATENSYRIANWITHGENOCIDE681-956.jpg uhm, syria, syrian, turkey, turkish, ww3, world, war, ufm, union, for, the, mediterranean, roman, empire, electricity, nwo, new, world, order, pope, jesuits, crusade, al-assad, libya, gaddafi ]]> EMPEROR CARLOS USES TURKEY TO THREATEN SYRIAN WITH GENOCIDE 3149B5BA-0FAA-11E1-911F-812DAD955C17 http://blip.tv/the-unhived-mind/phelps-craig-oxley-14-nov-2011-papal-city-of-london-5738121 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5738121 5721053 file TV-UN 0.0 2011-11-15T16:52:24Z English 0 0 0 3118 AYLenW0C http://blip.tv/play/AYLenW0C http://blip.tv/comments/?attached_to=post5738121&skin=rss Craigoxley-PHELPSCRAIGOXLEY14NOV2011PAPALCITYOFLONDON369-307.jpg No license (All rights reserved)
Listen to Eric Jon Phelps host Craig Oxley for the hour who gives you multiple angles to this grand conspiracy and how they connect with the ancient City of London. ]]> YahooPartnerVideoID Blip post id 5738121 http://blip.tv/file/5721053 Educational 911 ad providam admiralty law ancient british east india company cia city of london common law dope inc elizabeth mary freeman golden triangle heroin holy see hsbc jfk kennedy keswick knights of malta knights templar new jerusalem new world order nwo papa Tue, 15 Nov 2011 16:52:24 +0000 911, ad providam, admiralty law, ancient, british east india company, cia, city of london, common law, dope inc, elizabeth mary, freeman, golden triangle, heroin, holy see, hsbc, jfk, kennedy, keswick, knights of malta, knights templar, new jerusalem, new world order, nwo, papa http://a.images.blip.tv/Craigoxley-PHELPSCRAIGOXLEY14NOV2011PAPALCITYOFLONDON369-307.jpg 911, ad providam, admiralty law, ancient, british east india company, cia, city of london, common law, dope inc, elizabeth mary, freeman, golden triangle, heroin, holy see, hsbc, jfk, kennedy, keswick, knights of malta, knights templar, new jerusalem, new world order, nwo, papa ]]> PHELPS & CRAIG OXLEY 14/NOV/2011 – PAPAL CITY OF LONDON 32FD6FA6-0D06-11E1-9B69-A416DADDE49D http://blip.tv/the-unhived-mind/dr-bill-deagle-11th-nov-2011-earth-preparedness-hour-5730021 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5730021 5712940 file TV-UN 0.0 2011-11-12T08:13:27Z English 0 0 0 2306 AYLd3kkC http://blip.tv/play/AYLd3kkC http://blip.tv/comments/?attached_to=post5730021&skin=rss Craigoxley-DrBillDeagle11thNov2011EarthPreparednessHour289-542.jpg No license (All rights reserved)
Listen to Bill Deagle, J.R Moore and Ann Morrison host the Earth Preparedness Hour for November 11th 2011. ]]> YahooPartnerVideoID Blip post id 5730021 http://blip.tv/file/5712940 Educational mexico drug cartel cia marines earth preparedness hour nutrimedical report bill deagle john moore nuclear radiation earthquakes volcano storm gulf bird flu swine h1n1 h5n1 nwo order illuminati alex jones katrina crown fukushima japan tsunami knights malta Sat, 12 Nov 2011 08:13:27 +0000 mexico, drug, cartel, cia, marines, earth, preparedness, hour, nutrimedical, report, bill, deagle, john, moore, nuclear, radiation, earthquakes, volcano, storm, gulf, bird, flu, swine, h1n1, h5n1, nwo, order, illuminati, alex, jones, katrina, crown, fukushima, japan, tsunami, knights, malta http://a.images.blip.tv/Craigoxley-DrBillDeagle11thNov2011EarthPreparednessHour289-542.jpg mexico, drug, cartel, cia, marines, earth, preparedness, hour, nutrimedical, report, bill, deagle, john, moore, nuclear, radiation, earthquakes, volcano, storm, gulf, bird, flu, swine, h1n1, h5n1, nwo, order, illuminati, alex, jones, katrina, crown, fukushima, japan, tsunami, knights, malta ]]> Dr Bill Deagle - 11th Nov 2011 - Earth Preparedness Hour 8FA7DEC0-0CEE-11E1-9893-EA9570EA6B86 http://blip.tv/the-unhived-mind/episode-5729821 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5729821 5712740 file TV-UN 0.0 2011-11-12T05:24:15Z English 0 0 0 1584 AYLd3QEC http://blip.tv/play/AYLd3QEC http://blip.tv/comments/?attached_to=post5729821&skin=rss Craigoxley-test104-428.jpg No license (All rights reserved)
Listen to the Biblical Truth and History Radio Show of Eric Jon Phelps with guests Craig Oxley and Vittorio Vivaldi III Parts 1-2: http://www.youtube.com/watch?v=SOrgPBxcdm8 http://www.youtube.com/watch?v=I_8FwPubwqk ]]> YahooPartnerVideoID Blip post id 5729821 http://blip.tv/file/5712740 Educational nwo illuminati roman empire rome pope pontiff jesuits city london bishop cantebury royal gaddafi libya al-qaeda Sat, 12 Nov 2011 05:24:15 +0000 nwo, illuminati, roman, empire, rome, pope, pontiff, jesuits, city, london, bishop, cantebury, royal, gaddafi, libya, al-qaeda http://a.images.blip.tv/Craigoxley-test104-428.jpg nwo, illuminati, roman, empire, rome, pope, pontiff, jesuits, city, london, bishop, cantebury, royal, gaddafi, libya, al-qaeda ]]> ERIC PHELPS, CRAIG OXLEY & VITTORIO VIVALDI [ ACE864FC-0B7A-11E1-BB7F-826303979A39 http://blip.tv/the-unhived-mind/bob-chapman-9th-nov-2011-six-eurozones-to-drop-out-5723812 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5723812 5706728 file TV-UN 0.0 2011-11-10T09:02:11Z English 0 0 0 2888 AYLdrggC http://blip.tv/play/AYLdrggC http://blip.tv/comments/?attached_to=post5723812&skin=rss Craigoxley-BobChapman9thNov2011SixEurozonesToDropOut758-309.jpg No license (All rights reserved)
Listen to Bob Chapman and Melody Cedarstrom on the Financial Survival radio show broadcast on the 9th of November 2011. Parts 1-4: http://www.youtube.com/watch?v=nB_ob_04Lms http://www.youtube.com/watch?v=NR0pqjLqUII http://www.youtube.com/watch?v=vyM_ACCIf0I http://www.youtube.com/watch?v=Egh2eCX-Y2U ]]> YahooPartnerVideoID Blip post id 5723812 http://blip.tv/file/5706728 Educational commodity commodities bullion physical gold silver franc mark mining markets dow ftse economy economic depression recession recovery credit crunch social security medicare foreclosure default bankruptcy marines morgan shorts federal reserve imf cia foreca Thu, 10 Nov 2011 09:02:11 +0000 commodity, commodities, bullion, physical, gold, silver, franc, mark, mining, markets, dow, ftse, economy, economic, depression, recession, recovery, credit, crunch, social, security, medicare, foreclosure, default, bankruptcy, marines, morgan, shorts, federal, reserve, imf, cia, foreca http://a.images.blip.tv/Craigoxley-BobChapman9thNov2011SixEurozonesToDropOut758-309.jpg commodity, commodities, bullion, physical, gold, silver, franc, mark, mining, markets, dow, ftse, economy, economic, depression, recession, recovery, credit, crunch, social, security, medicare, foreclosure, default, bankruptcy, marines, morgan, shorts, federal, reserve, imf, cia, foreca ]]> Bob Chapman – 9th Nov 2011 – Six Eurozones To Drop Out 63FD63F8-0B77-11E1-A349-8B5399911094 http://blip.tv/the-unhived-mind/uhm-the-disease-increase-and-the-illusionary-virus-5723777 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5723777 5706693 file TV-UN 0.0 2011-11-10T08:38:40Z English 0 0 0 213 AYLdrWUC http://blip.tv/play/AYLdrWUC http://blip.tv/comments/?attached_to=post5723777&skin=rss Craigoxley-UHMTHEDISEASEINCREASEANDTHEILLUSIONARYVIRUS429-493.jpg No license (All rights reserved)
Notice the increase in STDs lately, wondered why? Also on Vimeo; http://vimeo.com/31892552 YT; http://www.youtube.com/watch?v=O3o7uC7ztPw Read this for the latest Syphilis attacks http://theunhivedmind.com/wordpress/?p=10796 ]]> YahooPartnerVideoID Blip post id 5723777 http://blip.tv/file/5706693 Educational the unhived mind uhm syphilis std freelove beast aleister crowley depopulation cor club of rome un agenda 21 dogging nwo new world order illuminati jesuits council of trent apothecares sustainable development robert gallo genocide hiv Thu, 10 Nov 2011 08:38:40 +0000 the, unhived, mind, uhm, syphilis, std, freelove, beast, aleister, crowley, depopulation, cor, club, of, rome, un, agenda, 21, dogging, nwo, new, world, order, illuminati, jesuits, council, of, trent, apothecares, sustainable, development, robert, gallo, genocide, hiv http://a.images.blip.tv/Craigoxley-UHMTHEDISEASEINCREASEANDTHEILLUSIONARYVIRUS429-493.jpg the, unhived, mind, uhm, syphilis, std, freelove, beast, aleister, crowley, depopulation, cor, club, of, rome, un, agenda, 21, dogging, nwo, new, world, order, illuminati, jesuits, council, of, trent, apothecares, sustainable, development, robert, gallo, genocide, hiv ]]> UHM - THE DISEASE INCREASE AND THE ILLUSIONARY VIRUS 1098EFCE-0B5A-11E1-AFCE-D0646B98FEFE http://blip.tv/the-unhived-mind/uhm-the-touchscreen-to-transhumanism-agenda-5723479 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5723479 5706395 file TV-UN 0.0 2011-11-10T05:08:45Z English 0 0 0 110 AYLdqzsC http://blip.tv/play/AYLdqzsC http://blip.tv/comments/?attached_to=post5723479&skin=rss Craigoxley-UHMTHETOUCHSCREENTOTRANSHUMANISMAGENDA770-306.jpg No license (All rights reserved)
Are you moving to all fingers all thumbs on a pad of delights of illusion? Well maybe this is why. Watch as you're conditioned with ego driven technology into the borg state aided by modern electria music played all day long via ipod earphones into the meridians from the ears. Welcome to New World Order http://www.youtube.com/watch?v=y9K6_6nddF8 Watch this http://www.youtube.com/watch?v=vaiRLpuwDZ0 ]]> YahooPartnerVideoID Blip post id 5723479 http://blip.tv/file/5706395 Art nwo hyperspace brain chips implants 666 beast borg software windows brainwashing mark of the beast new world order illuminati control the unhived mind technology cia mi6 technologists Thu, 10 Nov 2011 05:08:45 +0000 nwo, hyperspace, brain, chips, implants, 666, beast, borg, software, windows, brainwashing, mark, of, the, beast, new, world, order, illuminati, control, the, unhived, mind, technology, cia, mi6, technologists http://a.images.blip.tv/Craigoxley-UHMTHETOUCHSCREENTOTRANSHUMANISMAGENDA770-306.jpg nwo, hyperspace, brain, chips, implants, 666, beast, borg, software, windows, brainwashing, mark, of, the, beast, new, world, order, illuminati, control, the, unhived, mind, technology, cia, mi6, technologists ]]> UHM - THE TOUCHSCREEN TO TRANSHUMANISM AGENDA 13FF1FE6-0A9A-11E1-909C-9E31327E7597 http://blip.tv/the-unhived-mind/uhm-on-the-insurance-car-tracking-agenda-5720335 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5720335 5703249 file TV-UN 0.0 2011-11-09T06:14:27Z English 0 0 0 119 AYLdknMC http://blip.tv/play/AYLdknMC http://blip.tv/comments/?attached_to=post5720335&skin=rss Craigoxley-UHMONTHEINSURANCECARTRACKINGAGENDA779-383.jpg No license (All rights reserved)
First it came to young drivers then to the older generation as the fuel crisis expands as the Straits of Hommez get shut shortly. See what I'm getting at? This is a slow boil conditioning program to accept a total orwellian dictatorship which they hope you don't even see. Future generations will believe this is how life has always been and all traces of an unwatched society will be removed by the Haberdashers and Mercers from the education system. Read this for the whole article from the video; http://theunhivedmind.com/wordpress/?p=10547 http://www.youtube.com/watch?v=marAFvmD2H0 ]]> YahooPartnerVideoID Blip post id 5720335 http://blip.tv/file/5703249 Educational Wed, 09 Nov 2011 06:14:27 +0000 http://a.images.blip.tv/Craigoxley-UHMONTHEINSURANCECARTRACKINGAGENDA779-383.jpg ]]> UHM - ON THE INSURANCE CAR TRACKING AGENDA D3133128-0825-11E1-A9CF-E345BABE1B2A http://blip.tv/the-unhived-mind/webster-tarplay-5th-nov-2011-world-crisis-radio-5711229 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5711229 5694142 file TV-UN 0.0 2011-11-06T03:17:14Z English 0 0 0 4456 AYLcy2EC http://blip.tv/play/AYLcy2EC http://blip.tv/comments/?attached_to=post5711229&skin=rss Craigoxley-WEBSTERTARPLAY5THNOV2011WORLDCRISISRADIO860-136.jpg No license (All rights reserved)
Listen to Webster Tarpley on World Crisis Radio broadcast on November 5th 2011. Occupy Wall Street, Stay in homes with no foreclosures, Middle East and Iran war. Parts 1-5 on YT: http://www.youtube.com/watch?v=ieaRPBjMTNY http://www.youtube.com/watch?v=k8QEkFCXf_o http://www.youtube.com/watch?v=3yfTSRtZdCc http://www.youtube.com/watch?v=4DYBCJYOE1M http://www.youtube.com/watch?v=MqDHEx54ryc ]]> YahooPartnerVideoID Blip post id 5711229 http://blip.tv/file/5694142 Art debt ceiling depression recession credit crunch nasa derivative tax shuttle barack obama tea party koch brothers color revolution constitution bill rights freedom truth conspiracy economy bankrupt bankruptcy foreclosure default 9/11 911 wtc7 nwo order ale Sun, 06 Nov 2011 03:17:14 +0000 debt, ceiling, depression, recession, credit, crunch, nasa, derivative, tax, shuttle, barack, obama, tea, party, koch, brothers, color, revolution, constitution, bill, rights, freedom, truth, conspiracy, economy, bankrupt, bankruptcy, foreclosure, default, 9/11, 911, wtc7, nwo, order, ale http://a.images.blip.tv/Craigoxley-WEBSTERTARPLAY5THNOV2011WORLDCRISISRADIO860-136.jpg debt, ceiling, depression, recession, credit, crunch, nasa, derivative, tax, shuttle, barack, obama, tea, party, koch, brothers, color, revolution, constitution, bill, rights, freedom, truth, conspiracy, economy, bankrupt, bankruptcy, foreclosure, default, 9/11, 911, wtc7, nwo, order, ale ]]> WEBSTER TARPLAY - 5TH NOV 2011 - WORLD CRISIS RADIO 12E4041A-0760-11E1-A976-854C3AC7DFBF http://blip.tv/the-unhived-mind/dr-bill-deagle-4th-nov-2011-economic-depression-famine-5708977 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5708977 5691888 file TV-UN 0.0 2011-11-05T03:41:41Z English 0 0 0 2305 AYLcuhUC http://blip.tv/play/AYLcuhUC http://blip.tv/comments/?attached_to=post5708977&skin=rss Craigoxley-DRBILLDEAGLE4THNOV2011ECONOMICDEPRESSIONFAMINE291-691.jpg No license (All rights reserved)
Listen to Bill Deagle, J.R Moore, Ann Morrison & Robert Felix host the Earth Preparedness Hour for November 4th 2011 http://www.youtube.com/watch?v=uga7-it7xTI http://www.youtube.com/watch?v=vtQzBD9U91k http://www.youtube.com/watch?v=Vfnl3Thi1EA FULL ALL-IN-ONE VIDEO; http://vimeo.com/31634606 ]]> YahooPartnerVideoID Blip post id 5708977 http://blip.tv/file/5691888 Educational mexico drug cartel cia marines earth preparedness hour nutrimedical report bill deagle john moore nuclear radiation earthquakes volcano storm gulf bird flu swine h1n1 h5n1 nwo order illuminati alex jones katrina crown fukushima japan tsunami knights malta Sat, 05 Nov 2011 03:41:41 +0000 mexico, drug, cartel, cia, marines, earth, preparedness, hour, nutrimedical, report, bill, deagle, john, moore, nuclear, radiation, earthquakes, volcano, storm, gulf, bird, flu, swine, h1n1, h5n1, nwo, order, illuminati, alex, jones, katrina, crown, fukushima, japan, tsunami, knights, malta http://a.images.blip.tv/Craigoxley-DRBILLDEAGLE4THNOV2011ECONOMICDEPRESSIONFAMINE291-691.jpg mexico, drug, cartel, cia, marines, earth, preparedness, hour, nutrimedical, report, bill, deagle, john, moore, nuclear, radiation, earthquakes, volcano, storm, gulf, bird, flu, swine, h1n1, h5n1, nwo, order, illuminati, alex, jones, katrina, crown, fukushima, japan, tsunami, knights, malta ]]> DR BILL DEAGLE - 4TH NOV 2011 - ECONOMIC DEPRESSION & FAMINE 22C0C5BA-06B3-11E1-959B-FE4F3A87E9F1 http://blip.tv/the-unhived-mind/bob-chapman-03-nov-2011-a-marines-disquisition-5706326 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5706326 5689237 file TV-UN 0.0 2011-11-04T07:03:45Z English 0 0 0 3410 AYLcpToC http://blip.tv/play/AYLcpToC http://blip.tv/comments/?attached_to=post5706326&skin=rss Craigoxley-BOBCHAPMAN03NOV2011AMARINESDISQUISITION227-415.jpg No license (All rights reserved)
*Digitally enhanced and sound improved by The Unhived Mind This broadcast took place on the 3rd of November 2011 by Drew Malone Raines III on the A Marines Disquisition show "The Financial Hour" with Bob Chapman,"The International Forecaster" who enlightens us with the full investigative truth of the financial world much of which is distatched from his personal knowledge and friends from around the world. Mr. Chapman is the MOST Pledgerized Financial Advisor from around the world. Listen to untold truths about 9/11 which are shocking to even the alternative media. Also at Youtube; http://www.youtube.com/watch?v=6p4a9yMo6Yg http://www.youtube.com/watch?v=JYxXbLCPl84 http://www.youtube.com/watch?v=lJzUqc-esU4 http://www.youtube.com/watch?v=NEWTjhhsxbY ]]> YahooPartnerVideoID Blip post id 5706326 http://blip.tv/file/5689237 Educational bob chapman commodity commodities bullion physical gold silver platinum palladium stocks mining markets dow ftse economy economic depression recession recovery credit crunch social security medicare foreclosure default bankruptcy marines morgan shorts fed Fri, 04 Nov 2011 07:03:45 +0000 bob, chapman, commodity, commodities, bullion, physical, gold, silver, platinum, palladium, stocks, mining, markets, dow, ftse, economy, economic, depression, recession, recovery, credit, crunch, social, security, medicare, foreclosure, default, bankruptcy, marines, morgan, shorts, fed http://a.images.blip.tv/Craigoxley-BOBCHAPMAN03NOV2011AMARINESDISQUISITION227-415.jpg bob, chapman, commodity, commodities, bullion, physical, gold, silver, platinum, palladium, stocks, mining, markets, dow, ftse, economy, economic, depression, recession, recovery, credit, crunch, social, security, medicare, foreclosure, default, bankruptcy, marines, morgan, shorts, fed ]]> BOB CHAPMAN - 03 NOV 2011 - A MARINES DISQUISITION DE9F52FA-0696-11E1-9342-E42ABBA530F3 http://blip.tv/the-unhived-mind/iran-to-be-attacked-in-2012-as-cover-for-economic-collapse-5706023 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5706023 5688934 file TV-UN 0.0 2011-11-04T03:41:24Z English 0 0 0 578 AYLcowsC http://blip.tv/play/AYLcowsC http://blip.tv/comments/?attached_to=post5706023&skin=rss Craigoxley-IRANTOBEATTACKEDIN2012ASCOVERFORECONOMICCOLLAPSE834-211.jpg No license (All rights reserved)
You've noticed the propaganda in the media lately against Iran now Libya has been done with. The war will start shortly and the World will never be the same as populaces are forced into the New World Order. Also at: http://www.youtube.com/watch?v=kRR7QscQ3qo - Please check out my video on the coming Middle East problems back from the 21st Feb 2011; http://www.youtube.com/watch?v=SKRG9P4yWhI ]]> YahooPartnerVideoID Blip post id 5706023 http://blip.tv/file/5688934 Educational fuellers mercers haberdashers iran iranian nuclear centrifuge uranium united nations u.n security council wmd weapons war conflict ww3 straits hommez oil opec shia islam crusade koran brotherhood ufm union mediterranean king juan carlos roman empire zioni Fri, 04 Nov 2011 03:41:24 +0000 fuellers, mercers, haberdashers, iran, iranian, nuclear, centrifuge, uranium, united, nations, u.n, security, council, wmd, weapons, war, conflict, ww3, straits, hommez, oil, opec, shia, islam, crusade, koran, brotherhood, ufm, union, mediterranean, king, juan, carlos, roman, empire, zioni http://a.images.blip.tv/Craigoxley-IRANTOBEATTACKEDIN2012ASCOVERFORECONOMICCOLLAPSE834-211.jpg fuellers, mercers, haberdashers, iran, iranian, nuclear, centrifuge, uranium, united, nations, u.n, security, council, wmd, weapons, war, conflict, ww3, straits, hommez, oil, opec, shia, islam, crusade, koran, brotherhood, ufm, union, mediterranean, king, juan, carlos, roman, empire, zioni ]]> IRAN TO BE ATTACKED IN 2012 AS COVER FOR ECONOMIC COLLAPSE 87EC6EA0-05EE-11E1-98B0-EE1067B1EDF2 http://blip.tv/the-unhived-mind/bob-chapman-2nd-november-2011-financial-survival-w-melody-5702954 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 5702954 5685861 file TV-UN 0.0 2011-11-03T07:36:23Z English 0 0 0 2496 AYLciw4C http://blip.tv/play/AYLciw4C http://blip.tv/comments/?attached_to=post5702954&skin=rss Craigoxley-BobChapman2ndNovember2011FinancialSurvivalWMelody874-613.jpg No license (All rights reserved)
Listen to Bob Chapman and Melody Cedarstrom on the Financial Survival radio show broadcast on the 2nd of November 2011. ]]> YahooPartnerVideoID Blip post id 5702954 http://blip.tv/file/5685861 Educational commodity commodities bullion physical gold silver franc mark mining markets dow ftse economy economic depression recession recovery credit crunch social security medicare foreclosure default bankruptcy marines morgan shorts federal reserve imf cia foreca Thu, 03 Nov 2011 07:36:23 +0000 commodity, commodities, bullion, physical, gold, silver, franc, mark, mining, markets, dow, ftse, economy, economic, depression, recession, recovery, credit, crunch, social, security, medicare, foreclosure, default, bankruptcy, marines, morgan, shorts, federal, reserve, imf, cia, foreca http://a.images.blip.tv/Craigoxley-BobChapman2ndNovember2011FinancialSurvivalWMelody874-613.jpg commodity, commodities, bullion, physical, gold, silver, franc, mark, mining, markets, dow, ftse, economy, economic, depression, recession, recovery, credit, crunch, social, security, medicare, foreclosure, default, bankruptcy, marines, morgan, shorts, federal, reserve, imf, cia, foreca ]]> Bob Chapman - 2nd November 2011 - Financial Survival w/ Melody 54D0407C-3421-11E0-8A0A-BA907C0F395D http://blip.tv/the-unhived-mind/u-k-populace-are-being-conditioned-for-food-crisis-and-rationing-4760110 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4760110 4741925 file TV-UN 0.0 2011-02-09T07:50:58Z English 0 0 0 613 AYKixRIC http://blip.tv/play/AYKixRIC http://blip.tv/comments/?attached_to=post4760110&skin=rss Craigoxley-UKPOPULACEAREBEINGCONDITIONEDFORFOODCRISISANDRATIONING484-620.jpg http://a.images.blip.tv/Craigoxley-UKPOPULACEAREBEINGCONDITIONEDFORFOODCRISISANDRATIONING484-620-545.jpg No license (All rights reserved)
At this very minute the populace of the U.K are being subliminally conditioned to the coming food crisis and rationing which will take place. Only weeks ago TESCO announced to its loyalty card (Big Brother) customers that they'd be delving deeper into their customers purchases. Loyalty cards are so in the future supermarkets will know what your weekly shop usually is and then you'll no longer be able to purchase anything over this amount. The elitists do not want food hoarders as this doesn't allow for control. ]]> YahooPartnerVideoID Blip post id 4760110 http://blip.tv/file/4741925 Educational big society co-op co-operative food crisis hunger starvation poverty starving hungry gmo genetically modified rome vatican u.n w.f.p f.a.o aid bees pollen chemtrails nwo 9/11 911 wtc7 truth conspiracy order secret occult jesuits pope papacy nobility middl Wed, 09 Feb 2011 07:50:58 +0000 big, society, co-op, co-operative, food, crisis, hunger, starvation, poverty, starving, hungry, gmo, genetically, modified, rome, vatican, u.n, w.f.p, f.a.o, aid, bees, pollen, chemtrails, nwo, 9/11, 911, wtc7, truth, conspiracy, order, secret, occult, jesuits, pope, papacy, nobility, middl http://a.images.blip.tv/Craigoxley-UKPOPULACEAREBEINGCONDITIONEDFORFOODCRISISANDRATIONING484-620.jpg big, society, co-op, co-operative, food, crisis, hunger, starvation, poverty, starving, hungry, gmo, genetically, modified, rome, vatican, u.n, w.f.p, f.a.o, aid, bees, pollen, chemtrails, nwo, 9/11, 911, wtc7, truth, conspiracy, order, secret, occult, jesuits, pope, papacy, nobility, middl ]]> U.K. POPULACE ARE BEING CONDITIONED FOR FOOD CRISIS AND RATIONING A26F9AE2-341E-11E0-83BE-B928DBC10D15 http://blip.tv/the-unhived-mind/vatican-behind-codex-alimentarius-banning-of-health-4760071 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4760071 4741886 file TV-UN 0.0 2011-02-09T07:31:40Z English 0 0 0 475 AYKixGsC http://blip.tv/play/AYKixGsC http://blip.tv/comments/?attached_to=post4760071&skin=rss Craigoxley-VATICANBEHINDCODEXALIMENTARIUSBANNINGOFHEALTH865-498.jpg http://a.images.blip.tv/Craigoxley-VATICANBEHINDCODEXALIMENTARIUSBANNINGOFHEALTH865-498-373.jpg No license (All rights reserved)
Heres an email sent to a fellow herbalist + additional truths. This Codex is nothing more than profit, population control and reduction. Make sure you're aware of 'The Club of Rome' and their 'Global 2000 Report' also study 'Memorandum 200'. They want you dead, you don't think so? Check out; http://www.youtube.com/watch?v=fx0cVYkOtM8 Please check out;http://www.youtube.com/watch?v=eIOYzihb1Bkhttp://video.google.com/videoplay?docid=5800206429960925518#http://www.youtube.com/watch?v=SBaEs9sY-zMhttp://www.youtube.com/watch?v=hbmAum1vsNU ]]> YahooPartnerVideoID Blip post id 4760071 http://blip.tv/file/4741886 Educational Wed, 09 Feb 2011 07:31:40 +0000 http://a.images.blip.tv/Craigoxley-VATICANBEHINDCODEXALIMENTARIUSBANNINGOFHEALTH865-498.jpg ]]> VATICAN BEHIND CODEX ALIMENTARIUS BANNING OF HEALTH 3827CCB0-341C-11E0-A53A-A04A0CC19247 http://blip.tv/the-unhived-mind/mung-bean-prevention-and-reversal-of-cancer-2-2-4760039 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4760039 4741854 file TV-UN 0.0 2011-02-09T07:14:22Z English 0 0 0 419 AYKixEsC http://blip.tv/play/AYKixEsC http://blip.tv/comments/?attached_to=post4760039&skin=rss Craigoxley-MUNGBEANPREVENTIONANDREVERSALOFCANCER22855-682.jpg http://a.images.blip.tv/Craigoxley-MUNGBEANPREVENTIONANDREVERSALOFCANCER22855-682-755.jpg No license (All rights reserved)
Learn how the Mung bean can be used to keep you healthy and free from disease by its compounds which attack Cancer and clean out thousands of poisons from the body. Heres the list of herbs mentioned in the video: Blue Cohosh root, Baby's Breath flower, White Horehound herb, Basil herb, Thyme herb, Sage leaf, Couch Grass root, Linden flower, Mullein leaf, Marshmallow root, Solomon's Seal root, Chickweed herb, Asparagus root, Suma root, Culver's root, Fringe Tree Root bark, Cowslip root, Bittersweet stalk, Jamaican Sarsaparilla root, Rosemary leaf, White Deadnettle herb & root, Helonias root, Sea Holly root, Gravel root, Lily of the Valley herb, Hawthorn berry, Milky Oat berry, Yucca, Bright Bugleweed herb, Garden Balsam seed, Cowcockle seed, White Oxknee root, Lock Yang stem, Proud Pink herb, Asian Poke root, Caper Spurge seed, Rooting Lobelia herb & root, Japanese Dogwood berry, Cherokee Rosehip, Long Yam root, Jujube berry, Sour Jujube seed, Hemsleya tuber, Lychee seed, Bush Cherry kernal, Prince Ginseng root, Vohitoikidy, Mountain Yam root, Downy Bellflower root, Mimosa bark, Popcorn Senna, Oriental Arborvitae berry, Thin-Leaf Milkwort root, Selfheal Spike, Potato Yam tuber, Field Thistle herb & root, Great Burnet root, Waxgourd seed, Snakegourd fruit, Loquat leaf, Red Spike Thorn, Prime White root, Honeylocust pod, Sichuan Fritillary bulb, Abalo, Upright Ladybell root, Know Mother root, Dwarf Lilyturf root, Horsetail herb, Centipeda herb, Pseudoginseng root, Kochia seed, Rose of Sharon Root bark, Paris root, Wild Cassia, Spikemoss gerb, China root, Glabrous Greenbrier root, Winter Cherry herb, Worm-cure albizia, Japanese Honeysuckle flower, Soap Nut tree, Taiwan Schefflera leaf and stem, Red Stinkwood leaf & bark, Asian Buplever root, Prepared Giant Typhonium root, Prepared Dragon Arum Corm, Field Lotus herb, Chinese Quince fruit, Nippon Yam root. ]]> YahooPartnerVideoID Blip post id 4760039 http://blip.tv/file/4741854 Educational cancer illness chemo chemotherapy radiation radiotherapy xray death tumour tumor leukemia breast prostrate alternative health hollistic herbal herbs chinese medicial traditional medicine gerson christopher hoxsey kelley winters clover mung bean lu dou Wed, 09 Feb 2011 07:14:22 +0000 cancer, illness, chemo, chemotherapy, radiation, radiotherapy, xray, death, tumour, tumor, leukemia, breast, prostrate, alternative, health, hollistic, herbal, herbs, chinese, medicial, traditional, medicine, gerson, christopher, hoxsey, kelley, winters, clover, mung, bean, lu, dou http://a.images.blip.tv/Craigoxley-MUNGBEANPREVENTIONANDREVERSALOFCANCER22855-682.jpg cancer, illness, chemo, chemotherapy, radiation, radiotherapy, xray, death, tumour, tumor, leukemia, breast, prostrate, alternative, health, hollistic, herbal, herbs, chinese, medicial, traditional, medicine, gerson, christopher, hoxsey, kelley, winters, clover, mung, bean, lu, dou ]]> MUNG BEAN - PREVENTION AND REVERSAL OF CANCER (2/2) 03D38546-341A-11E0-90A7-E28227F3C50F http://blip.tv/the-unhived-mind/mung-bean-prevention-and-reversal-of-cancer-1-2-4760006 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4760006 4741821 file TV-UN 0.0 2011-02-09T06:58:35Z English 0 0 0 883 AYKixCoC http://blip.tv/play/AYKixCoC http://blip.tv/comments/?attached_to=post4760006&skin=rss Craigoxley-MUNGBEANPREVENTIONANDREVERSALOFCANCER12627-909.jpg http://a.images.blip.tv/Craigoxley-MUNGBEANPREVENTIONANDREVERSALOFCANCER12627-909-26.jpg No license (All rights reserved)
Learn how the Mung bean can be used to keep you healthy and free from disease by its compounds which attack Cancer and clean out thousands of poisons from the body. Heres the list of herbs mentioned in the video: Blue Cohosh root, Baby's Breath flower, White Horehound herb, Basil herb, Thyme herb, Sage leaf, Couch Grass root, Linden flower, Mullein leaf, Marshmallow root, Solomon's Seal root, Chickweed herb, Asparagus root, Suma root, Culver's root, Fringe Tree Root bark, Cowslip root, Bittersweet stalk, Jamaican Sarsaparilla root, Rosemary leaf, White Deadnettle herb & root, Helonias root, Sea Holly root, Gravel root, Lily of the Valley herb, Hawthorn berry, Milky Oat berry, Yucca, Bright Bugleweed herb, Garden Balsam seed, Cowcockle seed, White Oxknee root, Lock Yang stem, Proud Pink herb, Asian Poke root, Caper Spurge seed, Rooting Lobelia herb & root, Japanese Dogwood berry, Cherokee Rosehip, Long Yam root, Jujube berry, Sour Jujube seed, Hemsleya tuber, Lychee seed, Bush Cherry kernal, Prince Ginseng root, Vohitoikidy, Mountain Yam root, Downy Bellflower root, Mimosa bark, Popcorn Senna, Oriental Arborvitae berry, Thin-Leaf Milkwort root, Selfheal Spike, Potato Yam tuber, Field Thistle herb & root, Great Burnet root, Waxgourd seed, Snakegourd fruit, Loquat leaf, Red Spike Thorn, Prime White root, Honeylocust pod, Sichuan Fritillary bulb, Abalo, Upright Ladybell root, Know Mother root, Dwarf Lilyturf root, Horsetail herb, Centipeda herb, Pseudoginseng root, Kochia seed, Rose of Sharon Root bark, Paris root, Wild Cassia, Spikemoss gerb, China root, Glabrous Greenbrier root, Winter Cherry herb, Worm-cure albizia, Japanese Honeysuckle flower, Soap Nut tree, Taiwan Schefflera leaf and stem, Red Stinkwood leaf & bark, Asian Buplever root, Prepared Giant Typhonium root, Prepared Dragon Arum Corm, Field Lotus herb, Chinese Quince fruit, Nippon Yam root. ]]> YahooPartnerVideoID Blip post id 4760006 http://blip.tv/file/4741821 Educational cancer illness chemo chemotherapy radiation radiotherapy xray death tumour tumor leukemia breast prostrate alternative health hollistic herbal herbs chinese medicial traditional medicine gerson christopher hoxsey kelley winters clover mung bean lu dou pre Wed, 09 Feb 2011 06:58:35 +0000 cancer, illness, chemo, chemotherapy, radiation, radiotherapy, xray, death, tumour, tumor, leukemia, breast, prostrate, alternative, health, hollistic, herbal, herbs, chinese, medicial, traditional, medicine, gerson, christopher, hoxsey, kelley, winters, clover, mung, bean, lu, dou, pre http://a.images.blip.tv/Craigoxley-MUNGBEANPREVENTIONANDREVERSALOFCANCER12627-909.jpg cancer, illness, chemo, chemotherapy, radiation, radiotherapy, xray, death, tumour, tumor, leukemia, breast, prostrate, alternative, health, hollistic, herbal, herbs, chinese, medicial, traditional, medicine, gerson, christopher, hoxsey, kelley, winters, clover, mung, bean, lu, dou, pre ]]> MUNG BEAN - PREVENTION AND REVERSAL OF CANCER (1/2) 3C0B8BAA-3417-11E0-89EF-D1C612052B9B http://blip.tv/the-unhived-mind/all-uk-legislation-passed-since-2000-is-null-and-void-2-2-4759938 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4759938 4741753 file TV-UN 0.0 2011-02-09T06:38:41Z English 0 0 0 868 AYKiw2YC http://blip.tv/play/AYKiw2YC http://blip.tv/comments/?attached_to=post4759938&skin=rss Craigoxley-ALLUKLEGISLATIONPASSEDSINCE2000ISNULLANDVOID22417-605.jpg http://a.images.blip.tv/Craigoxley-ALLUKLEGISLATIONPASSEDSINCE2000ISNULLANDVOID22417-605-762.jpg No license (All rights reserved)
Please take note of important information about how Legislation since 2000 in the United Kingdom corporation has been null and void. The original information came from Edward Harle back in April of 2010 prior to his assassination not long after. ]]> YahooPartnerVideoID Blip post id 4759938 http://blip.tv/file/4741753 Educational u.k. legislation edward harle story null void e.u lisbon treaty lords peerage law government tony blair gordon brown union euro european nwo 9/11 911 wtc7 truth conspiracy order chaos secret society occult rite freemasonry jesuit vatican pope babylon Wed, 09 Feb 2011 06:38:41 +0000 u.k., legislation, edward, harle, story, null, void, e.u, lisbon, treaty, lords, peerage, law, government, tony, blair, gordon, brown, union, euro, european, nwo, 9/11, 911, wtc7, truth, conspiracy, order, chaos, secret, society, occult, rite, freemasonry, jesuit, vatican, pope, babylon http://a.images.blip.tv/Craigoxley-ALLUKLEGISLATIONPASSEDSINCE2000ISNULLANDVOID22417-605.jpg u.k., legislation, edward, harle, story, null, void, e.u, lisbon, treaty, lords, peerage, law, government, tony, blair, gordon, brown, union, euro, european, nwo, 9/11, 911, wtc7, truth, conspiracy, order, chaos, secret, society, occult, rite, freemasonry, jesuit, vatican, pope, babylon ]]> ALL UK LEGISLATION PASSED SINCE 2000 IS NULL AND VOID (2/2) F248AA0E-3414-11E0-8A18-9F9F8F3CED60 http://blip.tv/the-unhived-mind/all-uk-legislation-passed-since-2000-is-null-and-void-1-2-4759902 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4759902 4741717 file TV-UN 0.0 2011-02-09T06:22:19Z English 0 0 0 880 AYKiw0IC http://blip.tv/play/AYKiw0IC http://blip.tv/comments/?attached_to=post4759902&skin=rss Craigoxley-ALLUKLEGISLATIONPASSEDSINCE2000ISNULLANDVOID12719-646.jpg http://a.images.blip.tv/Craigoxley-ALLUKLEGISLATIONPASSEDSINCE2000ISNULLANDVOID12719-646-881.jpg No license (All rights reserved)
Please take note of important information about how Legislation since 2000 in the United Kingdom corporation has been null and void. The original information came from Edward Harle back in April of 2010 prior to his assassination not long after. ]]> YahooPartnerVideoID Blip post id 4759902 http://blip.tv/file/4741717 Educational u.k. legislation edward harle story null void e.u lisbon treaty lords peerage law government tony blair gordon brown union euro european nwo 9/11 911 wtc7 truth conspiracy order chaos secret society occult rite freemasonry jesuit vatican pope babylon worl Wed, 09 Feb 2011 06:22:19 +0000 u.k., legislation, edward, harle, story, null, void, e.u, lisbon, treaty, lords, peerage, law, government, tony, blair, gordon, brown, union, euro, european, nwo, 9/11, 911, wtc7, truth, conspiracy, order, chaos, secret, society, occult, rite, freemasonry, jesuit, vatican, pope, babylon, worl http://a.images.blip.tv/Craigoxley-ALLUKLEGISLATIONPASSEDSINCE2000ISNULLANDVOID12719-646.jpg u.k., legislation, edward, harle, story, null, void, e.u, lisbon, treaty, lords, peerage, law, government, tony, blair, gordon, brown, union, euro, european, nwo, 9/11, 911, wtc7, truth, conspiracy, order, chaos, secret, society, occult, rite, freemasonry, jesuit, vatican, pope, babylon, worl ]]> ALL UK LEGISLATION PASSED SINCE 2000 IS NULL AND VOID (1/2) C9C108B8-3411-11E0-AB66-8345F8C74DBB http://blip.tv/the-unhived-mind/knowledge-of-olive-leaf-extract-4-4-4759851 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4759851 4741666 file TV-UN 0.0 2011-02-09T05:59:42Z English 0 0 0 490 AYKiww8C http://blip.tv/play/AYKiww8C http://blip.tv/comments/?attached_to=post4759851&skin=rss Craigoxley-KNOWLEDGEOFOLIVELEAFEXTRACT44897-318.jpg http://a.images.blip.tv/Craigoxley-KNOWLEDGEOFOLIVELEAFEXTRACT44897-318-924.jpg No license (All rights reserved)
Information on this excellent anti-virus/fungal/bacterial ]]> YahooPartnerVideoID Blip post id 4759851 http://blip.tv/file/4741666 Art olive leaf olea europaea virus fungus bacteria antiviral antibiotic hiv h1n1 h5n1 swine flu cold pneumonia herb herbal oil health hollistic supplements energy adrenals lyme chronic fatigue 911 9/11 wtc7 truth conspiracy bioweapon plum island fever illness Wed, 09 Feb 2011 05:59:42 +0000 olive, leaf, olea, europaea, virus, fungus, bacteria, antiviral, antibiotic, hiv, h1n1, h5n1, swine, flu, cold, pneumonia, herb, herbal, oil, health, hollistic, supplements, energy, adrenals, lyme, chronic, fatigue, 911, 9/11, wtc7, truth, conspiracy, bioweapon, plum, island, fever, illness http://a.images.blip.tv/Craigoxley-KNOWLEDGEOFOLIVELEAFEXTRACT44897-318.jpg olive, leaf, olea, europaea, virus, fungus, bacteria, antiviral, antibiotic, hiv, h1n1, h5n1, swine, flu, cold, pneumonia, herb, herbal, oil, health, hollistic, supplements, energy, adrenals, lyme, chronic, fatigue, 911, 9/11, wtc7, truth, conspiracy, bioweapon, plum, island, fever, illness ]]> KNOWLEDGE OF OLIVE LEAF EXTRACT (4/4) 4F07D3F0-3410-11E0-A502-F4BC9AABECD7 http://blip.tv/the-unhived-mind/knowledge-of-olive-leaf-extract-3-4-4759829 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4759829 4741644 file TV-UN 0.0 2011-02-09T05:49:07Z English 0 0 0 898 AYKiwnkC http://blip.tv/play/AYKiwnkC http://blip.tv/comments/?attached_to=post4759829&skin=rss Craigoxley-KNOWLEDGEOFOLIVELEAFEXTRACT34971-902.jpg http://a.images.blip.tv/Craigoxley-KNOWLEDGEOFOLIVELEAFEXTRACT34971-902-614.jpg No license (All rights reserved)
Information on this excellent anti-virus/fungal/bacterial ]]> YahooPartnerVideoID Blip post id 4759829 http://blip.tv/file/4741644 Art olive leaf olea europaea virus fungus bacteria antiviral antibiotic hiv h1n1 h5n1 swine flu cold pneumonia herb herbal oil health hollistic supplements energy adrenals lyme chronic fatigue 911 9/11 wtc7 truth conspiracy bioweapon plum island fever illness Wed, 09 Feb 2011 05:49:07 +0000 olive, leaf, olea, europaea, virus, fungus, bacteria, antiviral, antibiotic, hiv, h1n1, h5n1, swine, flu, cold, pneumonia, herb, herbal, oil, health, hollistic, supplements, energy, adrenals, lyme, chronic, fatigue, 911, 9/11, wtc7, truth, conspiracy, bioweapon, plum, island, fever, illness http://a.images.blip.tv/Craigoxley-KNOWLEDGEOFOLIVELEAFEXTRACT34971-902.jpg olive, leaf, olea, europaea, virus, fungus, bacteria, antiviral, antibiotic, hiv, h1n1, h5n1, swine, flu, cold, pneumonia, herb, herbal, oil, health, hollistic, supplements, energy, adrenals, lyme, chronic, fatigue, 911, 9/11, wtc7, truth, conspiracy, bioweapon, plum, island, fever, illness ]]> KNOWLEDGE OF OLIVE LEAF EXTRACT (3/4) EBB520FC-340D-11E0-9C82-802322433ED9 http://blip.tv/the-unhived-mind/knowledge-of-olive-leaf-extract-2-4-4759787 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4759787 4741602 file TV-UN 0.0 2011-02-09T05:32:01Z English 0 0 0 897 AYKiwk8C http://blip.tv/play/AYKiwk8C http://blip.tv/comments/?attached_to=post4759787&skin=rss Craigoxley-KNOWLEDGEOFOLIVELEAFEXTRACT24200-339.jpg http://a.images.blip.tv/Craigoxley-KNOWLEDGEOFOLIVELEAFEXTRACT24200-339-652.jpg No license (All rights reserved)
Information on this excellent anti-virus/fungal/bacterial ]]> YahooPartnerVideoID Blip post id 4759787 http://blip.tv/file/4741602 Art olive leaf olea europaea virus fungus bacteria antiviral antibiotic hiv h1n1 h5n1 swine flu cold pneumonia herb herbal oil health hollistic supplements energy adrenals lyme chronic fatigue 911 9/11 wtc7 truth conspiracy bioweapon plum island fever illness Wed, 09 Feb 2011 05:32:01 +0000 olive, leaf, olea, europaea, virus, fungus, bacteria, antiviral, antibiotic, hiv, h1n1, h5n1, swine, flu, cold, pneumonia, herb, herbal, oil, health, hollistic, supplements, energy, adrenals, lyme, chronic, fatigue, 911, 9/11, wtc7, truth, conspiracy, bioweapon, plum, island, fever, illness http://a.images.blip.tv/Craigoxley-KNOWLEDGEOFOLIVELEAFEXTRACT24200-339.jpg olive, leaf, olea, europaea, virus, fungus, bacteria, antiviral, antibiotic, hiv, h1n1, h5n1, swine, flu, cold, pneumonia, herb, herbal, oil, health, hollistic, supplements, energy, adrenals, lyme, chronic, fatigue, 911, 9/11, wtc7, truth, conspiracy, bioweapon, plum, island, fever, illness ]]> KNOWLEDGE OF OLIVE LEAF EXTRACT (2/4) 7C0BC222-340A-11E0-B705-829932F5A49B http://blip.tv/the-unhived-mind/knowledge-of-olive-leaf-extract-1-4-4759731 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4759731 4741546 file TV-UN 0.0 2011-02-09T05:07:25Z English 0 0 0 899 AYKiwhcC http://blip.tv/play/AYKiwhcC http://blip.tv/comments/?attached_to=post4759731&skin=rss Craigoxley-KNOWLEDGEOFOLIVELEAFEXTRACT14462-568.jpg http://a.images.blip.tv/Craigoxley-KNOWLEDGEOFOLIVELEAFEXTRACT14462-568-442.jpg No license (All rights reserved)
Information on this excellent anti-virus/fungal/bacterial ]]> YahooPartnerVideoID Blip post id 4759731 http://blip.tv/file/4741546 Educational olive leaf olea europaea virus fungus bacteria antiviral antibiotic hiv h1n1 h5n1 swine flu cold pneumonia herb herbal oil health hollistic supplements energy adrenals lyme chronic fatigue 911 9/11 wtc7 truth conspiracy bioweapon plum island fever illness Wed, 09 Feb 2011 05:07:25 +0000 olive, leaf, olea, europaea, virus, fungus, bacteria, antiviral, antibiotic, hiv, h1n1, h5n1, swine, flu, cold, pneumonia, herb, herbal, oil, health, hollistic, supplements, energy, adrenals, lyme, chronic, fatigue, 911, 9/11, wtc7, truth, conspiracy, bioweapon, plum, island, fever, illness http://a.images.blip.tv/Craigoxley-KNOWLEDGEOFOLIVELEAFEXTRACT14462-568.jpg olive, leaf, olea, europaea, virus, fungus, bacteria, antiviral, antibiotic, hiv, h1n1, h5n1, swine, flu, cold, pneumonia, herb, herbal, oil, health, hollistic, supplements, energy, adrenals, lyme, chronic, fatigue, 911, 9/11, wtc7, truth, conspiracy, bioweapon, plum, island, fever, illness ]]> KNOWLEDGE OF OLIVE LEAF EXTRACT (1/4) 59DA2426-3407-11E0-A641-9C41620AB6D4 http://blip.tv/the-unhived-mind/pope-benedict-xvi-the-freemason-4759672 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4759672 4741487 file TV-UN 0.0 2011-02-09T04:44:59Z English 0 0 0 32 AYKiwVwC http://blip.tv/play/AYKiwVwC http://blip.tv/comments/?attached_to=post4759672&skin=rss Craigoxley-POPEBENEDICTXVITHEFREEMASON209-812.jpg http://a.images.blip.tv/Craigoxley-POPEBENEDICTXVITHEFREEMASON209-812-803.jpg No license (All rights reserved)
Watch the handshake and remember the Grand Lodge Ekklesia. ]]> YahooPartnerVideoID Blip post id 4759672 http://blip.tv/file/4741487 Art pope popish ratzinger benedict xvi rome vatican freemason freemasonry mason masonry grand lodge ugle ekklesia nwo jesuits sepulchre knights malta teutonic templar montesa ihs satan lucifer satanism satanic luciferism handshake saturn illuminati 911 9/11 w Wed, 09 Feb 2011 04:44:59 +0000 pope, popish, ratzinger, benedict, xvi, rome, vatican, freemason, freemasonry, mason, masonry, grand, lodge, ugle, ekklesia, nwo, jesuits, sepulchre, knights, malta, teutonic, templar, montesa, ihs, satan, lucifer, satanism, satanic, luciferism, handshake, saturn, illuminati, 911, 9/11, w http://a.images.blip.tv/Craigoxley-POPEBENEDICTXVITHEFREEMASON209-812.jpg pope, popish, ratzinger, benedict, xvi, rome, vatican, freemason, freemasonry, mason, masonry, grand, lodge, ugle, ekklesia, nwo, jesuits, sepulchre, knights, malta, teutonic, templar, montesa, ihs, satan, lucifer, satanism, satanic, luciferism, handshake, saturn, illuminati, 911, 9/11, w ]]> POPE BENEDICT XVI THE FREEMASON D6CC9B8C-3405-11E0-8EB2-AC4EF6D75DE1 http://blip.tv/the-unhived-mind/leo-zagami-occultic-all-seeing-eye-of-the-two-generals-of-the-world-4759638 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4759638 4741453 file TV-UN 0.0 2011-02-09T04:34:10Z English 0 0 0 542 AYKiwToC http://blip.tv/play/AYKiwToC http://blip.tv/comments/?attached_to=post4759638&skin=rss Craigoxley-LEOZAGAMIOCCULTICALLSEEINGEYEOFTHETWOGENERALSOFTHEW151-615.jpg http://a.images.blip.tv/Craigoxley-LEOZAGAMIOCCULTICALLSEEINGEYEOFTHETWOGENERALSOFTHEW151-615-692.jpg No license (All rights reserved)
This is part of an interview conducted with Leo Lyon Zagami in December 2010. You will hear and see even more exposure of the most deadly of all the orders. The revived Knights Templar are back and in complete control. ROMAN EMPIRE POWER OVER CHINA & THE FAR EAST http://www.youtube.com/watch?v=k7iVMPuovf4JESUIT ILLUMINIZED OCCULT http://www.youtube.com/watch?v=k7iVMPuovf4Walter Veith-The Islamic Connection http://www.youtube.com/watch?v=AllwO-ejxGE ]]> YahooPartnerVideoID Blip post id 4759638 http://blip.tv/file/4741453 Educational leo lyon zagami illuminati vatican occult jesuits society jesus templar knight witchcraft satanism luciferian lucifer satan horus isis sun solar cult zeus saturn el allah islam catholicism babylon mysteries freemason masonry masonic eye seeing god ra bibl Wed, 09 Feb 2011 04:34:10 +0000 leo, lyon, zagami, illuminati, vatican, occult, jesuits, society, jesus, templar, knight, witchcraft, satanism, luciferian, lucifer, satan, horus, isis, sun, solar, cult, zeus, saturn, el, allah, islam, catholicism, babylon, mysteries, freemason, masonry, masonic, eye, seeing, god, ra, bibl http://a.images.blip.tv/Craigoxley-LEOZAGAMIOCCULTICALLSEEINGEYEOFTHETWOGENERALSOFTHEW151-615.jpg leo, lyon, zagami, illuminati, vatican, occult, jesuits, society, jesus, templar, knight, witchcraft, satanism, luciferian, lucifer, satan, horus, isis, sun, solar, cult, zeus, saturn, el, allah, islam, catholicism, babylon, mysteries, freemason, masonry, masonic, eye, seeing, god, ra, bibl ]]> LEO ZAGAMI - OCCULTIC ALL SEEING EYE OF THE TWO GENERALS OF THE WORLD 8DD178B6-0283-11E0-9B4A-E29A9E30DFE6 http://blip.tv/the-unhived-mind/shimon-peres-confronted-for-handing-jerusalem-to-the-vatican-4500523 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4500523 4482018 file TV-UN 0.0 2010-12-08T04:28:06Z English 0 0 0 696 AYKS2Q8C http://blip.tv/play/AYKS2Q8C http://blip.tv/comments/?attached_to=post4500523&skin=rss Craigoxley-SHIMONPERESCONFRONTEDFORHANDINGJERUSALEMTOTHEVATICAN738-446.jpg http://a.images.blip.tv/Craigoxley-SHIMONPERESCONFRONTEDFORHANDINGJERUSALEMTOTHEVATICAN738-446-484.jpg Public Domain
An interview by Barry Chamish with his guest on the Barry Chamish Radio Show November 10th 2010. His guest confronted Jesuit trained Shimon Peres on his connection to the OSLO ACCORDS and the VATICAN whilst in the Hebrew University.Full Interview:http://wwfar.com/mp3s/BarryChamish/BARRY.HR1.MP3http://wwfar.com/mp3s/BarryChamish/BARRY.HR2.MP3 ]]> http://blip.tv/file/4482018 Educational shimon peres oslo accords declaration principles vatican israel jerusalem jesuits ratzinger pope benedict cfr knights malta sepulchre teutonic templar king juan carlos meditteranean union order nwo 9/11 911 zionism zionist molech el baal zeus sabbatean fr Wed, 08 Dec 2010 04:28:06 +0000 shimon, peres, oslo, accords, declaration, principles, vatican, israel, jerusalem, jesuits, ratzinger, pope, benedict, cfr, knights, malta, sepulchre, teutonic, templar, king, juan, carlos, meditteranean, union, order, nwo, 9/11, 911, zionism, zionist, molech, el, baal, zeus, sabbatean, fr http://a.images.blip.tv/Craigoxley-SHIMONPERESCONFRONTEDFORHANDINGJERUSALEMTOTHEVATICAN738-446.jpg shimon, peres, oslo, accords, declaration, principles, vatican, israel, jerusalem, jesuits, ratzinger, pope, benedict, cfr, knights, malta, sepulchre, teutonic, templar, king, juan, carlos, meditteranean, union, order, nwo, 9/11, 911, zionism, zionist, molech, el, baal, zeus, sabbatean, fr ]]> SHIMON PERES CONFRONTED FOR HANDING JERUSALEM TO THE VATICAN http://creativecommons.org/licenses/publicdomain/ 1662C480-E125-11DF-8018-B9F7A115D0F6 http://blip.tv/the-unhived-mind/old-europe-power-currently-over-the-world-the-moslems-4316643 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4316643 4297969 file TV-UN 0.0 2010-10-26T17:18:45Z English 0 0 0 895 AYKHvEcC http://blip.tv/play/AYKHvEcC http://blip.tv/comments/?attached_to=post4316643&skin=rss Craigoxley-OldEuropePowerCurrentlyOverTheWorldTheMoslems757-439.jpg http://a.images.blip.tv/Craigoxley-OldEuropePowerCurrentlyOverTheWorldTheMoslems757-439-367.jpg No license (All rights reserved)
Highlighting the real power over the globe and Middle East along with symbolism and what lies ahead.The real forces behind the creation of the movie version of 'Angels & Demons' and King Solomon's Third Temple and far more. Its time the real enemy was exposed. For further research of your own, study the Spanish Inquisitional power of Borgo Pio (mostly shipped to Shanghai, China and Vietnam) along with Borgo Santo Spirito.I also suggest people research all the work of Prof Walter J. Veith and his Total Onslaught series. You should study the Islamic Connection episode closely. ]]> YahooPartnerVideoID Blip post id 4316643 http://blip.tv/file/4297969 Educational vatican jesuit opus dei malta knights templar freemason zion zionist zionism jew israel jerusalem peres sabbatean frankist illuminati union bavarian catholic rome meditteranean king carlos lucifer satan horus osiris isis occult secret society witchcraft s Tue, 26 Oct 2010 17:18:45 +0000 vatican, jesuit, opus, dei, malta, knights, templar, freemason, zion, zionist, zionism, jew, israel, jerusalem, peres, sabbatean, frankist, illuminati, union, bavarian, catholic, rome, meditteranean, king, carlos, lucifer, satan, horus, osiris, isis, occult, secret, society, witchcraft, s http://a.images.blip.tv/Craigoxley-OldEuropePowerCurrentlyOverTheWorldTheMoslems757-439.jpg vatican, jesuit, opus, dei, malta, knights, templar, freemason, zion, zionist, zionism, jew, israel, jerusalem, peres, sabbatean, frankist, illuminati, union, bavarian, catholic, rome, meditteranean, king, carlos, lucifer, satan, horus, osiris, isis, occult, secret, society, witchcraft, s ]]> Old Europe Power Currently Over The World & The Moslems 000702FC-D011-11DF-827A-8601849BE931 http://blip.tv/the-unhived-mind/black-nobility-to-collapse-economy-via-thermo-nuclear-detonation-in-spain-4223067 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4223067 4204295 file TV-UN 0.0 2010-10-04T23:42:07Z English 0 0 0 803 AYKB4T8C http://blip.tv/play/AYKB4T8C http://blip.tv/comments/?attached_to=post4223067&skin=rss Craigoxley-BLACKNOBILITYTOCOLLAPSEECONOMYVIATHERMONUCLEARDETONATION638-75.jpg http://a.images.blip.tv/Craigoxley-BLACKNOBILITYTOCOLLAPSEECONOMYVIATHERMONUCLEARDETONATION638-75-555.jpg No license (All rights reserved)
A very high level meeting in about to take place within weeks. The economy is in dire shape as the people awaken to the control structure of the invisible prison. Europe may well feel the next false flag terrorist event by the false enemy (Iron Mountain Report).For More Info on the Nuke attacks:http://www.disclose.tv/action/viewvideo/44972/Dimitri_Khalezov___WTC_Nuclear_Demolition_1_26/ ]]> YahooPartnerVideoID Blip post id 4223067 http://blip.tv/file/4204295 Educational terrorism terrorist nuclear nuke suitcase mini-nuke ward vialls dimitri khalezov bout viktor cia fsb sis mossad granit juan carlos depression recession recovery crunch credit foreclosure unemployment collapse iraq iran islam moslem koran war vatican jesui Mon, 04 Oct 2010 23:42:07 +0000 terrorism, terrorist, nuclear, nuke, suitcase, mini-nuke, ward, vialls, dimitri, khalezov, bout, viktor, cia, fsb, sis, mossad, granit, juan, carlos, depression, recession, recovery, crunch, credit, foreclosure, unemployment, collapse, iraq, iran, islam, moslem, koran, war, vatican, jesui http://a.images.blip.tv/Craigoxley-BLACKNOBILITYTOCOLLAPSEECONOMYVIATHERMONUCLEARDETONATION638-75.jpg terrorism, terrorist, nuclear, nuke, suitcase, mini-nuke, ward, vialls, dimitri, khalezov, bout, viktor, cia, fsb, sis, mossad, granit, juan, carlos, depression, recession, recovery, crunch, credit, foreclosure, unemployment, collapse, iraq, iran, islam, moslem, koran, war, vatican, jesui ]]> BLACK NOBILITY TO COLLAPSE ECONOMY VIA THERMO-NUCLEAR DETONATION IN SPAIN 1D8BEF58-CE96-11DF-A465-C555587E3E78 http://blip.tv/the-unhived-mind/chemtrails-subliminal-on-x-factor-tv-show-4215085 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4215085 4196307 file TV-UN 0.0 2010-10-03T02:29:58Z English 0 0 0 181 AYKBoxEC http://blip.tv/play/AYKBoxEC http://blip.tv/comments/?attached_to=post4215085&skin=rss Craigoxley-ChemtrailsSubliminalOnXFactorTVShow278-208.jpg http://a.images.blip.tv/Craigoxley-ChemtrailsSubliminalOnXFactorTVShow278-208-509.jpg No license (All rights reserved)
Yet more subtle social engineering from the trend setters of the Tavistock Institute and The Keepers of the Time. ]]> YahooPartnerVideoID Blip post id 4215085 http://blip.tv/file/4196307 Educational x-factor xfactor cher lloyd cheryl cole simon cowell louis walsh occult witchcraft nwo world order holy see jesuits ugle freemason freemasonry masonry mason zion zionist zionism temple crown malta templar knights chaos revolution war islam christianity at Sun, 03 Oct 2010 02:29:58 +0000 x-factor, xfactor, cher, lloyd, cheryl, cole, simon, cowell, louis, walsh, occult, witchcraft, nwo, world, order, holy, see, jesuits, ugle, freemason, freemasonry, masonry, mason, zion, zionist, zionism, temple, crown, malta, templar, knights, chaos, revolution, war, islam, christianity, at http://a.images.blip.tv/Craigoxley-ChemtrailsSubliminalOnXFactorTVShow278-208.jpg x-factor, xfactor, cher, lloyd, cheryl, cole, simon, cowell, louis, walsh, occult, witchcraft, nwo, world, order, holy, see, jesuits, ugle, freemason, freemasonry, masonry, mason, zion, zionist, zionism, temple, crown, malta, templar, knights, chaos, revolution, war, islam, christianity, at ]]> Chemtrails subliminal on X-Factor TV Show 07899652-CB4D-11DF-B06B-C34DB5AB3FB6 http://blip.tv/the-unhived-mind/hamid-karzai-the-agent-of-the-king-of-jerusalem-4196791 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4196791 4177999 file TV-UN 0.0 2010-09-28T22:09:14Z English 0 0 0 336 AYKAlBsC http://blip.tv/play/AYKAlBsC http://blip.tv/comments/?attached_to=post4196791&skin=rss Craigoxley-HAMIDKARZAITHEAGENTOFTHEKINGOFJERUSALEM435-649.jpg http://a.images.blip.tv/Craigoxley-HAMIDKARZAITHEAGENTOFTHEKINGOFJERUSALEM435-649-90.jpg No license (All rights reserved)
Hamid Karzai cries for Afghanistan or does he?See who secretly rules this man and who his puppet masters really are. ]]> YahooPartnerVideoID Blip post id 4196791 http://blip.tv/file/4177999 Educational hamid karzai george bush obama osama afghanistan war iraq islam zionist zionism zion rome pope vatican crusade holy see lucifer peter saturn satan horus isis set occult jesuits society secret 666 conspiracy wtc 911 9/11 dvd cia mossad mi6 jerusalem israel Tue, 28 Sep 2010 22:09:14 +0000 hamid, karzai, george, bush, obama, osama, afghanistan, war, iraq, islam, zionist, zionism, zion, rome, pope, vatican, crusade, holy, see, lucifer, peter, saturn, satan, horus, isis, set, occult, jesuits, society, secret, 666, conspiracy, wtc, 911, 9/11, dvd, cia, mossad, mi6, jerusalem, israel http://a.images.blip.tv/Craigoxley-HAMIDKARZAITHEAGENTOFTHEKINGOFJERUSALEM435-649.jpg hamid, karzai, george, bush, obama, osama, afghanistan, war, iraq, islam, zionist, zionism, zion, rome, pope, vatican, crusade, holy, see, lucifer, peter, saturn, satan, horus, isis, set, occult, jesuits, society, secret, 666, conspiracy, wtc, 911, 9/11, dvd, cia, mossad, mi6, jerusalem, israel ]]> HAMID KARZAI THE AGENT OF THE KING OF JERUSALEM 6DC59A6E-C40F-11DF-BDA8-F5E830DB8768 http://blip.tv/the-unhived-mind/satan-s-soldiers-and-the-suppression-of-earth-s-people-4158650 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4158650 4139826 file TV-UN 0.0 2010-09-19T17:00:38Z English 0 0 0 676 AYH96h4C http://blip.tv/play/AYH96h4C http://blip.tv/comments/?attached_to=post4158650&skin=rss Craigoxley-SATANSSOLDIERSANDTHESUPPRESSIONOFEARTHSPEOPLE953-767.jpg http://a.images.blip.tv/Craigoxley-SATANSSOLDIERSANDTHESUPPRESSIONOFEARTHSPEOPLE953-767-145.jpg No license (All rights reserved)
The Soldiers of Satan constantly lie and manipulate the populace of this World daily via their media systems. Force social engineering upon the people through pseudo-science and laws. As we enter the Age of Aquarius we enter into a darkened Satanic society pushed as good for us when in fact its a nightmare. You'll see clearly the enemy in this video. Keep your eyes on the person at the end of the video. You may just be seeing a lot more of him after the Iran war to come. ]]> YahooPartnerVideoID Blip post id 4158650 http://blip.tv/file/4139826 Educational kent hovind walter veith icke tsarion maxwell illuminati nwo order chaos society hidden secret zionism zion zionist mason freemason lucifer satan horus isis set babylon astronomy cia fbi mossad mi6 911 9/11 wtc truth loyola jesuits papacy vatican holy see Sun, 19 Sep 2010 17:00:38 +0000 kent, hovind, walter, veith, icke, tsarion, maxwell, illuminati, nwo, order, chaos, society, hidden, secret, zionism, zion, zionist, mason, freemason, lucifer, satan, horus, isis, set, babylon, astronomy, cia, fbi, mossad, mi6, 911, 9/11, wtc, truth, loyola, jesuits, papacy, vatican, holy, see http://a.images.blip.tv/Craigoxley-SATANSSOLDIERSANDTHESUPPRESSIONOFEARTHSPEOPLE953-767.jpg kent, hovind, walter, veith, icke, tsarion, maxwell, illuminati, nwo, order, chaos, society, hidden, secret, zionism, zion, zionist, mason, freemason, lucifer, satan, horus, isis, set, babylon, astronomy, cia, fbi, mossad, mi6, 911, 9/11, wtc, truth, loyola, jesuits, papacy, vatican, holy, see ]]> SATAN'S SOLDIERS AND THE SUPPRESSION OF EARTH'S PEOPLE D43A64A2-C3EF-11DF-9A0C-FB9DCECE686A http://blip.tv/the-unhived-mind/papal-antichrist-hyde-park-popemobile-2010-09-18-4158127 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4158127 4139303 file TV-UN 0.0 2010-09-19T13:14:26Z English 0 0 0 18 AYH95hMC http://blip.tv/play/AYH95hMC http://blip.tv/comments/?attached_to=post4158127&skin=rss notfound-episode.png No license (All rights reserved)
Troyspace gives the Pontiff what for on his devilish State visit to the U.K. in London. ]]> YahooPartnerVideoID Blip post id 4158127 http://blip.tv/file/4139303 Educational papal pope papacy vatican holy see roman empire protestant protest reformation christianity bible jesus satan lucifer horus isis set babylon solomon jesuit society loyola general illuminati nwo knight malta templar teutonic sepulchre constantine emperor e Sun, 19 Sep 2010 13:14:26 +0000 papal, pope, papacy, vatican, holy, see, roman, empire, protestant, protest, reformation, christianity, bible, jesus, satan, lucifer, horus, isis, set, babylon, solomon, jesuit, society, loyola, general, illuminati, nwo, knight, malta, templar, teutonic, sepulchre, constantine, emperor, e http://a.images.blip.tv/notfound-episode.png papal, pope, papacy, vatican, holy, see, roman, empire, protestant, protest, reformation, christianity, bible, jesus, satan, lucifer, horus, isis, set, babylon, solomon, jesuit, society, loyola, general, illuminati, nwo, knight, malta, templar, teutonic, sepulchre, constantine, emperor, e ]]> Papal Antichrist - Hyde Park Popemobile - 2010 09 18 E0E86FEA-C193-11DF-8A12-E427C33F560A http://blip.tv/the-unhived-mind/elizabeth-s-speech-to-pope-sept-2010-scotland-4147357 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4147357 4128519 file TV-UN 0.0 2010-09-16T13:11:12Z English 0 0 0 87 AYH9kgEC http://blip.tv/play/AYH9kgEC http://blip.tv/comments/?attached_to=post4147357&skin=rss notfound-episode.png No license (All rights reserved)
Treason ]]> YahooPartnerVideoID Blip post id 4147357 http://blip.tv/file/4128519 Educational queen pope papal holy see vatican jesuits opus dei sepulchre malta templar occult secret society order chaos nwo world governance tyrant mason masonic masonry freemason zionism zionist zion israel rome city crown Thu, 16 Sep 2010 13:11:12 +0000 queen, pope, papal, holy, see, vatican, jesuits, opus, dei, sepulchre, malta, templar, occult, secret, society, order, chaos, nwo, world, governance, tyrant, mason, masonic, masonry, freemason, zionism, zionist, zion, israel, rome, city, crown http://a.images.blip.tv/notfound-episode.png queen, pope, papal, holy, see, vatican, jesuits, opus, dei, sepulchre, malta, templar, occult, secret, society, order, chaos, nwo, world, governance, tyrant, mason, masonic, masonry, freemason, zionism, zionist, zion, israel, rome, city, crown ]]> Elizabeth's speech to Pope Sept 2010 Scotland 38470C8E-C044-11DF-81F1-F0EDA38903D0 http://blip.tv/the-unhived-mind/the-american-republic-is-crumbing-rapidly-4140082 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4140082 4121237 file TV-UN 0.0 2010-09-14T21:08:27Z English 0 0 0 567 AYH82RYC http://blip.tv/play/AYH82RYC http://blip.tv/comments/?attached_to=post4140082&skin=rss Craigoxley-THEAMERICANREPUBLICISCRUMBINGRAPIDLY257-211.jpg http://a.images.blip.tv/Craigoxley-THEAMERICANREPUBLICISCRUMBINGRAPIDLY257-211-347.jpg No license (All rights reserved)
David Kaiser comments on the rapid descent of the United States into a spiral of death and becoming a third World nation.David Kaiser is a respected historian whose published works have covered a broad range of topics, from European Warfare to American League Baseball. Born in 1947, the son of a diplomat, Kaiser spent his childhood in three capital cities: Washington DC., Albany, New York, and Dakar, Senegal. He attended Harvard University, graduating in 1969 with a B.A. in history. He then spent several years more at Harvard, gaining a PhD in history, which he obtained in 1976. He served in the Army Reserve from 1970 to 1976.He is a professor in the Strategy and Policy Department of the United States Naval War College. He has previously taught at Carnegie Mellon, Williams College and Harvard University. Kaiser's latest book, The Road to Dallas, about the Kennedy assassination, was just published by Harvard University Press. ]]> YahooPartnerVideoID Blip post id 4140082 http://blip.tv/file/4121237 Educational 911 9/11 wtc terrorist economy economic collapse credit crunch depression recession recovery gold bullion dollar currency libor peak vatican jesuit pope holy roman empire rome papacy inquisition israel zion zionist zionism truth illuminati icke tsarion jo Tue, 14 Sep 2010 21:08:27 +0000 911, 9/11, wtc, terrorist, economy, economic, collapse, credit, crunch, depression, recession, recovery, gold, bullion, dollar, currency, libor, peak, vatican, jesuit, pope, holy, roman, empire, rome, papacy, inquisition, israel, zion, zionist, zionism, truth, illuminati, icke, tsarion, jo http://a.images.blip.tv/Craigoxley-THEAMERICANREPUBLICISCRUMBINGRAPIDLY257-211.jpg 911, 9/11, wtc, terrorist, economy, economic, collapse, credit, crunch, depression, recession, recovery, gold, bullion, dollar, currency, libor, peak, vatican, jesuit, pope, holy, roman, empire, rome, papacy, inquisition, israel, zion, zionist, zionism, truth, illuminati, icke, tsarion, jo ]]> THE AMERICAN REPUBLIC IS CRUMBING RAPIDLY A3C32168-B37A-11DF-80D5-A775EA8F4548 http://blip.tv/the-unhived-mind/the-roots-of-the-global-green-climate-worship-agenda-4077974 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4077974 4059086 file TV-UN 0.0 2010-08-29T14:35:15Z English 0 0 0 669 AYH483oC http://blip.tv/play/AYH483oC http://blip.tv/comments/?attached_to=post4077974&skin=rss Craigoxley-THEROOTSOFTHEGLOBALGREENCLIMATEWORSHIPAGENDA813-868.jpg http://a.images.blip.tv/Craigoxley-THEROOTSOFTHEGLOBALGREENCLIMATEWORSHIPAGENDA813-868-809.jpg No license (All rights reserved)
The populace of the Globe are being brought together as one under the false reincarnated Mother Gaia religion. This is guised in a more modern times veil in order to fool the populaces. The whole idea of this is to destroy national sovereignty, cultures and tongues whilst allowing for a one World system to be put in its place. A false system needs to be put in place to replace the old system of war. This is all so Roman elite families of the Holy Roman Empire can continue to control the World even without the old war systems always used in the past. The populaces are to be dumbed down and entertained to sleep whilst the plot thickens and continues until the Luciferian 'Great Work' is completed. A depopulation agenda during all this continues as sixty plus percent of the Global populace is to be removed from the planet as wished for by the 'Global 2000' report from the Club of Rome. What we are left with is a life of no jobs or hope during the Post Industrial Zero Growth Society as in the past when the British East India Company destroyed civilisations of the past. ]]> YahooPartnerVideoID Blip post id 4077974 http://blip.tv/file/4059086 Educational fsc charles garter bath climate co2 al gore jesuit vatican papacy holy see roman empire pagan bible green geneva av1611 copenhagen chemtrails geoengineering horus isis set satan lucifer jesus god gaia mother earth summit warming ice age cooling climategat Sun, 29 Aug 2010 14:35:15 +0000 fsc, charles, garter, bath, climate, co2, al, gore, jesuit, vatican, papacy, holy, see, roman, empire, pagan, bible, green, geneva, av1611, copenhagen, chemtrails, geoengineering, horus, isis, set, satan, lucifer, jesus, god, gaia, mother, earth, summit, warming, ice, age, cooling, climategat http://a.images.blip.tv/Craigoxley-THEROOTSOFTHEGLOBALGREENCLIMATEWORSHIPAGENDA813-868.jpg fsc, charles, garter, bath, climate, co2, al, gore, jesuit, vatican, papacy, holy, see, roman, empire, pagan, bible, green, geneva, av1611, copenhagen, chemtrails, geoengineering, horus, isis, set, satan, lucifer, jesus, god, gaia, mother, earth, summit, warming, ice, age, cooling, climategat ]]> THE ROOTS OF THE GLOBAL GREEN CLIMATE WORSHIP AGENDA EB9009A4-B2BA-11DF-846F-A0B041A9BFE4 http://blip.tv/the-unhived-mind/world-war-iii-zionism-vs-islam-kolvenbach-carlos-4075333 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4075333 4056445 file TV-UN 0.0 2010-08-28T15:42:53Z English 0 0 0 595 AYH43ykC http://blip.tv/play/AYH43ykC http://blip.tv/comments/?attached_to=post4075333&skin=rss Craigoxley-WORLDWARIIIKOLVENBACHCARLOSZIONISMVSISLAM524-746.jpg http://a.images.blip.tv/Craigoxley-WORLDWARIIIKOLVENBACHCARLOSZIONISMVSISLAM524-746-641.jpg No license (All rights reserved)
This is the very popular truth video on the current Crusade and future escalation into World War III recently removed from Youtube due to its almost 10,000 hits. A new improved version is available as can be seen but this original must also be available with its few extras included.Truth in this lifetime of lies must prevail. ]]> YahooPartnerVideoID Blip post id 4075333 http://blip.tv/file/4056445 Educational Sat, 28 Aug 2010 15:42:53 +0000 http://a.images.blip.tv/Craigoxley-WORLDWARIIIKOLVENBACHCARLOSZIONISMVSISLAM524-746.jpg ]]> WORLD WAR III - ZIONISM VS ISLAM - KOLVENBACH & CARLOS 175F67D4-AAFD-11DF-97E5-9D7D9EEBE2DB http://blip.tv/the-unhived-mind/the-assassination-of-america-and-the-conspiracy-behind-it-4037930 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4037930 4019036 file TV-UN 0.0 2010-08-18T19:16:24Z English 0 0 0 900 AYH2uw4C http://blip.tv/play/AYH2uw4C http://blip.tv/comments/?attached_to=post4037930&skin=rss Craigoxley-THEASSASSINATIONOFAMERICAANDTHECONSPIRACYBEHINDIT893-698.jpg http://a.images.blip.tv/Craigoxley-THEASSASSINATIONOFAMERICAANDTHECONSPIRACYBEHINDIT893-698-38.jpg No license (All rights reserved)
The united states of America has been taken over. The covert coup d'état to destroy the states and bring about a Global dictatorship took place right under everyones noses since the 19th Century. One of the final attacks to finish off America once and for all is the engineered economic collapse to come between December 2010-July 2011 onwards. ]]> YahooPartnerVideoID Blip post id 4037930 http://blip.tv/file/4019036 Educational william mckinley ronald reagan abraham lincoln assassination banksters illuminati jesuits jesus bible rome reformation occult society order chaos degree vatican papacy pope papal holy see nobility elite knights templar malta teutonic sepulchre jerusalem z Wed, 18 Aug 2010 19:16:24 +0000 william, mckinley, ronald, reagan, abraham, lincoln, assassination, banksters, illuminati, jesuits, jesus, bible, rome, reformation, occult, society, order, chaos, degree, vatican, papacy, pope, papal, holy, see, nobility, elite, knights, templar, malta, teutonic, sepulchre, jerusalem, z http://a.images.blip.tv/Craigoxley-THEASSASSINATIONOFAMERICAANDTHECONSPIRACYBEHINDIT893-698.jpg william, mckinley, ronald, reagan, abraham, lincoln, assassination, banksters, illuminati, jesuits, jesus, bible, rome, reformation, occult, society, order, chaos, degree, vatican, papacy, pope, papal, holy, see, nobility, elite, knights, templar, malta, teutonic, sepulchre, jerusalem, z ]]> THE ASSASSINATION OF AMERICA AND THE CONSPIRACY BEHIND IT 6137BFDE-A641-11DF-BB4C-86F0824C2DA7 http://blip.tv/the-unhived-mind/the-global-oil-conspiracy-dr-david-kelly-the-falkland-islands-4016866 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 4016866 3997967 file TV-UN 0.0 2010-08-12T18:42:37Z English 0 0 0 899 AYH1lkYC http://blip.tv/play/AYH1lkYC http://blip.tv/comments/?attached_to=post4016866&skin=rss Craigoxley-THEGLOBALOILCONSPIRACYDRDAVIDKELLYTHEFALKLANDISLANDS756-381.jpg http://a.images.blip.tv/Craigoxley-THEGLOBALOILCONSPIRACYDRDAVIDKELLYTHEFALKLANDISLANDS756-381-325.jpg No license (All rights reserved)
There is a Global conspiracy at work as you read this very text. This video exposes some of the most major controllers of this conspiracy whilst highlighting reasons for why you are witnessing and hearing what you are in the media at this minute. The truth must be told! ]]> YahooPartnerVideoID Blip post id 4016866 http://blip.tv/file/3997967 Educational david kelly iraq islam zionist zion jew israel jerusalem vatican pope jesuits papal nobility bloodline occult satan jesus horus isis oil crusade assassination knights malta templar teutonic falkland islands drilling deepwater horizon transocean unocal bus Thu, 12 Aug 2010 18:42:37 +0000 david, kelly, iraq, islam, zionist, zion, jew, israel, jerusalem, vatican, pope, jesuits, papal, nobility, bloodline, occult, satan, jesus, horus, isis, oil, crusade, assassination, knights, malta, templar, teutonic, falkland, islands, drilling, deepwater, horizon, transocean, unocal, bus http://a.images.blip.tv/Craigoxley-THEGLOBALOILCONSPIRACYDRDAVIDKELLYTHEFALKLANDISLANDS756-381.jpg david, kelly, iraq, islam, zionist, zion, jew, israel, jerusalem, vatican, pope, jesuits, papal, nobility, bloodline, occult, satan, jesus, horus, isis, oil, crusade, assassination, knights, malta, templar, teutonic, falkland, islands, drilling, deepwater, horizon, transocean, unocal, bus ]]> THE GLOBAL OIL CONSPIRACY - DR. DAVID KELLY & THE FALKLAND ISLANDS B6DA94FA-91AD-11DF-BFA2-8AE2A667216F http://blip.tv/the-unhived-mind/eric-jon-phelps-on-feminism-july-16-2010-3912808 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 3912808 3893835 file TV-UN 0.0 2010-07-17T14:15:12Z English 0 0 0 3735 AYHu6UwC http://blip.tv/play/AYHu6UwC http://blip.tv/comments/?attached_to=post3912808&skin=rss notfound-episode.png No license (All rights reserved)
Truth on Feminism being the foundation for abortion and chaos in society. ]]> YahooPartnerVideoID Blip post id 3912808 http://blip.tv/file/3893835 Educational Sat, 17 Jul 2010 14:15:12 +0000 http://a.images.blip.tv/notfound-episode.png ]]> Eric Jon Phelps on Feminism July 16 2010 F12FF288-90D3-11DF-AD66-DF751B5B7CCB http://blip.tv/the-unhived-mind/the-12th-crusade-zionism-vs-islam-world-war-3-3908652 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 3908652 3889678 file TV-UN 0.0 2010-07-16T12:16:20Z English 0 0 0 593 AYHuyRAC http://blip.tv/play/AYHuyRAC http://blip.tv/comments/?attached_to=post3908652&skin=rss Craigoxley-THE12THCRUSADEZIONISMVSISLAMWORLDWAR3432-11.jpg http://a.images.blip.tv/Craigoxley-THE12THCRUSADEZIONISMVSISLAMWORLDWAR3432-11-868.jpg No license (All rights reserved)
Peter Hans Kolvenbach, SJ and HRH King Juan Carlos of Spain are planning for the destruction of the current Global system. They're preparing the final collapse of the World economy and the final World War.This video is a remake of a previous video. Quality has been greatly improved including many new additions and corrections.For more; http://z10.invisionfree.com/The_Unhived_Mind_II/index.php?showtopic=27272Watch the older version at; http://www.youtube.com/watch?v=dlYzKiyvMoY ]]> YahooPartnerVideoID Blip post id 3908652 http://blip.tv/file/3889678 Educational zion zionist zionism vatican papacy holy see inquisition jesuit society jesus company secret occult 666 isis horus set crusade juan carlos kolvenbach pope general templar malta teutonic knight grandmaster islam koran bible talmud sabbatean frankist hofjud Fri, 16 Jul 2010 12:16:20 +0000 zion, zionist, zionism, vatican, papacy, holy, see, inquisition, jesuit, society, jesus, company, secret, occult, 666, isis, horus, set, crusade, juan, carlos, kolvenbach, pope, general, templar, malta, teutonic, knight, grandmaster, islam, koran, bible, talmud, sabbatean, frankist, hofjud http://a.images.blip.tv/Craigoxley-THE12THCRUSADEZIONISMVSISLAMWORLDWAR3432-11.jpg zion, zionist, zionism, vatican, papacy, holy, see, inquisition, jesuit, society, jesus, company, secret, occult, 666, isis, horus, set, crusade, juan, carlos, kolvenbach, pope, general, templar, malta, teutonic, knight, grandmaster, islam, koran, bible, talmud, sabbatean, frankist, hofjud ]]> THE 12TH CRUSADE - ZIONISM VS ISLAM - WORLD WAR 3 BDF609D2-8130-11DF-90CE-B4E29B29C156 http://blip.tv/the-unhived-mind/craig-oxley-presents-multiple-intelligence-part-ii-3825495 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 3825495 3806455 file TV-UN 0.0 2010-06-26T14:40:18Z English 0 0 0 3846 AYHpvzsC http://blip.tv/play/AYHpvzsC http://blip.tv/comments/?attached_to=post3825495&skin=rss notfound-episode.png No license (All rights reserved)
February 11th 2009The agenda against the future and present societySpiritual prisonsThe Papal Bloodline+ more ]]> YahooPartnerVideoID Blip post id 3825495 http://blip.tv/file/3806455 Educational health herbs medicine society secret occult vatican jesuit illuminati icke tsarion maxwell templar malta teutonic sepulchre crusade reformation papal papacy pope rome mithra religion satan lucifer saturn jupiter peter jesus bible holy freemason masonry ri Sat, 26 Jun 2010 14:40:18 +0000 health, herbs, medicine, society, secret, occult, vatican, jesuit, illuminati, icke, tsarion, maxwell, templar, malta, teutonic, sepulchre, crusade, reformation, papal, papacy, pope, rome, mithra, religion, satan, lucifer, saturn, jupiter, peter, jesus, bible, holy, freemason, masonry, ri http://a.images.blip.tv/notfound-episode.png health, herbs, medicine, society, secret, occult, vatican, jesuit, illuminati, icke, tsarion, maxwell, templar, malta, teutonic, sepulchre, crusade, reformation, papal, papacy, pope, rome, mithra, religion, satan, lucifer, saturn, jupiter, peter, jesus, bible, holy, freemason, masonry, ri ]]> Craig Oxley Presents Multiple Intelligence Part II 57CDB57C-7B97-11DF-AEB6-E931F13C691D http://blip.tv/the-unhived-mind/vittorio-on-eric-phelps-show-about-papal-nobility-june-18-2010-3795302 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 3795302 3776233 file TV-UN 0.0 2010-06-19T11:39:38Z English 0 0 0 2117 AYHn00oC http://blip.tv/play/AYHn00oC http://blip.tv/comments/?attached_to=post3795302&skin=rss notfound-episode.png No license (All rights reserved)
More on the Jesuit Council and Papal Nobility bloodlines of the Ptolemaic Dynasties of Egypt. ]]> YahooPartnerVideoID Blip post id 3795302 http://blip.tv/file/3776233 Educational egypt vatican papacy holy see bible geneva illuminati nobility papal jesuit council ptolemaic nwo order chaos freemasonry mason satan lucifer god jesus christ saturn ptah horus set isis osiris 666 antichrist knight malta templar teutonic icke maxwell tsar Sat, 19 Jun 2010 11:39:38 +0000 egypt, vatican, papacy, holy, see, bible, geneva, illuminati, nobility, papal, jesuit, council, ptolemaic, nwo, order, chaos, freemasonry, mason, satan, lucifer, god, jesus, christ, saturn, ptah, horus, set, isis, osiris, 666, antichrist, knight, malta, templar, teutonic, icke, maxwell, tsar http://a.images.blip.tv/notfound-episode.png egypt, vatican, papacy, holy, see, bible, geneva, illuminati, nobility, papal, jesuit, council, ptolemaic, nwo, order, chaos, freemasonry, mason, satan, lucifer, god, jesus, christ, saturn, ptah, horus, set, isis, osiris, 666, antichrist, knight, malta, templar, teutonic, icke, maxwell, tsar ]]> Vittorio on Eric Phelps show about Papal Nobility June 18 2010 40896706-7AC2-11DF-AB65-FE8F8B479D60 http://blip.tv/the-unhived-mind/jesuit-illuminized-occult-3791414 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 3791414 3772342 file TV-UN 0.0 2010-06-18T10:14:16Z English 0 0 0 599 AYHntRoC http://blip.tv/play/AYHntRoC http://blip.tv/comments/?attached_to=post3791414&skin=rss Craigoxley-JESUITILLUMINIZEDOCCULT961-626.jpg http://a.images.blip.tv/Craigoxley-JESUITILLUMINIZEDOCCULT961-626-993.jpg No license (All rights reserved)
Learn how the Jesuits are riddled with the occult World.For more; http://z10.invisionfree.com/The_Unhived_Mind_II/ ]]> YahooPartnerVideoID Blip post id 3791414 http://blip.tv/file/3772342 Educational jesuits freemasonry mason lucifer satan saturn venus isis horus ra set occult illuminati secret society order chaos malta templar teutonic nun papacy church bible reformation av1511 cromwell nwo u.n agenda icke tsarion djinn islam koran jerusalem zionist Fri, 18 Jun 2010 10:14:16 +0000 jesuits, freemasonry, mason, lucifer, satan, saturn, venus, isis, horus, ra, set, occult, illuminati, secret, society, order, chaos, malta, templar, teutonic, nun, papacy, church, bible, reformation, av1511, cromwell, nwo, u.n, agenda, icke, tsarion, djinn, islam, koran, jerusalem, zionist http://a.images.blip.tv/Craigoxley-JESUITILLUMINIZEDOCCULT961-626.jpg jesuits, freemasonry, mason, lucifer, satan, saturn, venus, isis, horus, ra, set, occult, illuminati, secret, society, order, chaos, malta, templar, teutonic, nun, papacy, church, bible, reformation, av1511, cromwell, nwo, u.n, agenda, icke, tsarion, djinn, islam, koran, jerusalem, zionist ]]> JESUIT ILLUMINIZED OCCULT B3D59380-7705-11DF-992E-BD76A6ACE036 http://blip.tv/the-unhived-mind/the-true-13-bloodlines-of-the-illuminati-3768664 craigoxley 377894 unhived the-unhived-mind THE UNHIVED MIND http://blip.tv/the-unhived-mind http://blip.tv/skin/blipnew/placeholder_user.gif 3768664 3749580 file TV-UN 0.0 2010-06-13T16:07:02Z English 0 0 0 600 AYHmgzwC http://blip.tv/play/AYHmgzwC http://blip.tv/comments/?attached_to=post3768664&skin=rss Craigoxley-THETRUE13BLOODLINESOFTHEILLUMINATI579-710.jpg http://a.images.blip.tv/Craigoxley-THETRUE13BLOODLINESOFTHEILLUMINATI579-710-447.jpg No license (All rights reserved)
So you thought you knew who the bloodlines were within the Illuminist covert system? Did you think Fritz Springmeier was all knowing? You do not know the bloodlines in complete control of this planets populace. When you view this video you will finally be in the knowledge of the real thirteen bloodlines that rule the World behind the gray shadows. ]]> YahooPartnerVideoID Blip post id 3768664 http://blip.tv/file/3749580 Educational illuminati papacy vatican holy see crusade pope general grandmaster freemasonry satan jesus bible venus saturn brotherhood chaos order secret occult society icke tsarion maxwell knight templar malta teutonic brethen lucifer light wisdom jesuits sepulchre Sun, 13 Jun 2010 16:07:02 +0000 illuminati, papacy, vatican, holy, see, crusade, pope, general, grandmaster, freemasonry, satan, jesus, bible, venus, saturn, brotherhood, chaos, order, secret, occult, society, icke, tsarion, maxwell, knight, templar, malta, teutonic, brethen, lucifer, light, wisdom, jesuits, sepulchre http://a.images.blip.tv/Craigoxley-THETRUE13BLOODLINESOFTHEILLUMINATI579-710.jpg illuminati, papacy, vatican, holy, see, crusade, pope, general, grandmaster, freemasonry, satan, jesus, bible, venus, saturn, brotherhood, chaos, order, secret, occult, society, icke, tsarion, maxwell, knight, templar, malta, teutonic, brethen, lucifer, light, wisdom, jesuits, sepulchre ]]> THE TRUE 13 BLOODLINES OF THE ILLUMINATI